KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275021Help
Entry
DDB_G0275021      CDS       T00245                                 

Gene name
ubpB
Definition
deubiquinating enzyme
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 451 aa AA seqDB search
MKNIEEMPSKSQLVAHRSRGLINTSNTCFMNVILQSLTGCQLFLRVIKNLSDLEDLGKYP
TLHSFNQFYTEYFSNPTSNILNNNSNSTTTTSSSSTTATTTSTSNNNKSQTPTSPIQQHH
QSQTNGLSNQPSVATQSQQQQQPQPPINPKHFNDLVKSFNSKVSPVPQTTVSPHSMVQVS
KKKLKLQLYNNSLPQTICQQDAQEFLVFLLDLIHEEFLTLIKDIDIPKEDDKSTPTSTSI
VDDNWEVVGKKGKTAIITNSQQELPKTPISQIFSGVLRSSFNRTGSKESITVEPFYCLHL
DIRPEEINSLEDALKFFMKPEIIEGYTCSTKKIEISASKSWSFESLPRILIVHFKRFAFE
SDTSKKLDKLIRFPTQLSLSTASNHQTQKKYSLFSVVSHHGRGLSQGHYTCDIYQPQQAQ
WIRYDDSTFTEVKEQDVLNREAYLLLYQLVN
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagaggaaatgccatcaaaatcacaattagttgctcatagatcaagaggt
ttaatcaatacctcaaatacttgtttcatgaatgttatccttcaatctttaacaggttgt
caattgtttttaagggttattaaaaatttatcagatttagaagatttaggaaaatatcca
actttacatagttttaaccaattttatacagaatatttttcaaatcctacttcaaatata
ttgaataataatagtaattcaacaacaacaacatcttcatcttcaactacagctacaaca
acatcaacatcaaataataataaatcgcaaacaccaacatcaccaatacaacaacatcat
cagagtcaaactaatggtttaagtaatcaaccatcagtagcaacacaatcacaacaacaa
caacaaccacaaccaccaattaatccgaaacattttaatgatttagttaaatcatttaat
tcaaaagtatcaccagtacctcaaacaaccgtttcacctcattcaatggttcaagtttca
aaaaagaaattaaaacttcaactttataataattcgttaccacaaactatttgtcaacaa
gatgctcaagaatttttagtattccttttagatttaattcatgaagaatttttaacatta
ataaaagatattgatataccaaaagaggatgataaatcaacaccaacatcaacatcaatt
gttgacgataattgggaagtagttggtaaaaagggtaaaactgcaatcattacaaatagt
caacaagaattaccaaaaactccaatttcacaaatattttcaggtgttttaagaagtagt
tttaatagaaccggaagtaaagaatcaattacagttgaaccattttattgtttacatttg
gatattagaccagaagagattaatagtttagaggatgcacttaaattctttatgaaacca
gagattattgaaggttatacatgttcaactaaaaagattgaaatatcagcttcaaagagt
tggtcctttgaatcattaccaagaattttaattgttcatttcaagaggtttgcttttgag
agtgatacttcaaagaaattggataaattaattcgtttcccaactcaattatcactttca
accgcttcaaatcatcaaactcaaaagaaatactcactattctctgtcgttagtcatcat
ggtagaggtttatctcaaggtcattacacttgtgatatctatcaaccacaacaagctcaa
tggattagatatgatgattcaacttttactgaagtaaaagaacaagatgttttaaataga
gaagcttatctattattatatcaacttgttaattaa

DBGET integrated database retrieval system