KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275029Help
Entry
DDB_G0275029      CDS       T00245                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DDB_G0275029 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DDB_G0275029 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    DDB_G0275029 (odhB)
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DDB_G0275029 (odhB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 439 aa AA seqDB search
MRSATKLIKNVNINRCVQSNVVRSTSRLINNNSINTVRQFTSSSSSSFTSLFNNNNVNNT
NIKYQRFYSSANDVVIKVPSMGDSISEGTIVAWTKNVGDSVRVDEVVCSIETDKVTIDIN
APVSGTIVELFAKEGENVTVGNDLYKIAKGEVAAAPKVEAPKAAEAPKAAAPTPAPKAAE
TPKAAPAPKSEAPTPAPKSTTTTTSTGPSETRVKMTRIRQRTAQRLKDSQNTAAMLTTFN
ELDMSALMNMRKTYKDEFEKKHGVKFGFMSAFVKASTIALKEQPIVNASVEENDIVYHNN
VNINVAVSAPRGLVVPVIRNCENLSFADIEKEIGRLSGLARNDALAIEDSIGGTFTISNG
GVFGSMFGTPIINPPQSAILGMHAIKDRPYVVNGQVVVRPIMYLALTYDHRIIDGREAVT
FLKKIKDVLENPERILLEL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagatctgcaaccaaattaattaaaaacgtaaacatcaatagatgtgttcaatcaaat
gttgttagatcaactagtagattaattaataataacagtatcaacactgttagacaattt
acttcatcatcatcctcatcattcacttcattattcaacaataataatgtgaataataca
aatattaaatatcaacgtttttactcatctgcaaatgatgtagttattaaagtaccatca
atgggtgactctatttctgaaggtacaatcgttgcttggacaaagaatgttggtgatagt
gttagagttgatgaagttgtttgtagtattgaaacagataaagttacaattgatattaat
gcaccagtttcaggtacaattgtagaattatttgccaaagaaggggaaaatgttacagta
ggtaatgatctttacaaaattgccaaaggtgaagttgcagcagcaccaaaagttgaagca
ccaaaagcagcagaagcaccaaaagcagcagcaccaacaccagcaccaaaagcagctgaa
acaccaaaagcagcaccagcaccaaaatctgaagcaccaaccccagcaccaaaatcaact
accaccaccacctcaacaggaccatcagaaacacgtgttaaaatgacacgtattcgtcaa
agaacagcacaaagattaaaggattcacaaaatacagcagcaatgttaacaacattcaac
gaattagatatgtcagctctcatgaacatgagaaagacctacaaagatgaatttgaaaag
aaacatggtgttaaatttggtttcatgagtgcatttgtaaaggcatcaaccatcgccctc
aaagaacaaccaatcgtcaatgcctcagtcgaagagaatgatatcgtctatcacaataac
gttaatatcaatgttgcagtctcagcaccaagaggtttagttgtcccagtcattcgtaac
tgtgaaaacttgtcatttgctgacattgaaaaggagattggtcgtctctctggtctcgct
cgtaatgatgctttagccatcgaagatagtatcggtggtactttcacaatttcaaatggt
ggagttttcggttcaatgtttggtaccccaatcattaatccaccacaatctgccatcctt
ggtatgcacgccatcaaagatagaccatacgttgtcaatggtcaagttgtagttagacca
atcatgtatttagctcttacctatgatcacagaattatcgatggtagagaagccgtaact
ttcttaaagaaaattaaagatgttctcgaaaatccagaaagaattttattagaattataa

DBGET integrated database retrieval system