KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275515Help
Entry
DDB_G0275515      CDS       T00245                                 

Gene name
asnB
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DDB_G0275515 (asnB)
Enzymes [BR:ddi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DDB_G0275515 (asnB)
Peptidases [BR:ddi01002]
 Cysteine Peptidases
  Family C44
   DDB_G0275515 (asnB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 647 aa AA seqDB search
MCGISGWVDWSNKNDLLKEVAIIQRMNQSVYHRGPEEGGIWKSSDALFGHRRLCVIDAAG
GKQPMIFKKGDKSIVLCFNGELYNFQDLRNELISLGNQFKSHSDTEVILMSYIQWGEQCV
KKFNGMFAVAIFDEENQKLFLARDHLGVKPLFYCTRGDSILFGSEMKVLLANNKLVKAEV
DKDGIAQLFYLGAFRTPDIGCIFKDIHEVSPGHSITFNKSLNNNNNNNNNNNNNNNNNNN
NNISFTTTGQKEYWNLKCLPHTDDVHQTSKKLRGLIEGALSRQLISDVPITFLLSGGLSS
SVLVSLASSLSKSSFPEPCPINETSILKTFSCEFENDDKDYKEEIEGPKKPWVEKVVKNV
QSNHISTQCNVDNLINTISLPMKARDLPSFSKWETPLRLMLNKVKDHGVVLISDEGSDEI
FSGYDWFKKQSSLNMDRLPWIGNIYNNINHFLKDQILEQVDFMKYGEQVYQKAIKNMPVL
QGEDETQVKQRVASWLFIKYFLVYMLEREDRTSMSQSLEVRVPYCDYNLVEYCWNIPYNM
KSIDDIEKGILRRSMAQQLPKDILYHTKDNFPLSVKDTNFFISVCSLLEIELNNPSSPIL
NFIKKESIMEIIKNKYDEKYQTYQNQSVIEHLLQVNTWIIDYNVKFV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattagtggttgggtagattggtcaaataaaaatgatttattaaaagaagtt
gcaataattcaaagaatgaatcaaagtgtttatcatagaggaccagaggaaggtggaatt
tggaaatcaagtgatgcattatttggacatcgtagattatgtgttattgatgcagcaggt
ggtaaacaaccaatgatttttaaaaaaggtgataaatcaattgtattatgttttaatggg
gaattatataattttcaagatttaagaaatgaattaatttctttgggtaatcaatttaaa
agtcattctgatactgaagtaattctaatgtcatatattcaatggggtgaacaatgtgtt
aaaaagtttaacggaatgtttgcagttgcaatctttgatgaagaaaaccaaaaattattc
cttgcaagagatcatcttggtgttaaaccattattctattgtactagaggtgattccatt
ctttttggttcagaaatgaaagttttactagcaaataataaattggttaaagcagaagtt
gataaagatggtattgctcaattattttatttgggtgcatttcgtacaccagatattggt
tgtatatttaaagatatacatgaagtatcacctggacattcaattacatttaataaatca
ttaaataataataataataataataataataataataataataataataataataataat
aataatatctctttcactacaactggtcaaaaagaatattggaatttaaaatgtttacca
catactgatgatgttcatcaaacaagtaaaaaacttagaggattaattgaaggtgcactt
tcaagacaattaatatcagatgtaccaattacatttttattatctggtggtttatcatct
agtgtattggtttcattggcatcatcactatcgaaatcatcatttcctgaaccatgtcca
attaatgaaactagtattttgaaaactttttcatgtgaatttgaaaatgatgataaagat
tataaagaagaaattgaaggaccaaaaaaaccatgggttgaaaaggttgttaaaaatgtt
caaagtaatcatatttccacacaatgtaatgttgataatttaataaatacaatttcatta
ccaatgaaagcaagagatcttccaagtttttcaaaatgggaaacaccattaagactaatg
ctaaacaaagtaaaagatcatggtgtggttttaatctctgatgaaggttctgatgaaata
ttctctggttatgattggttcaaaaaacaatcttctttaaatatggatagattaccatgg
attggcaatatctataataatatcaatcatttcttaaaggatcaaatattagaacaagtt
gattttatgaaatatggtgagcaagtctatcaaaaagccattaaaaacatgccagtgcta
caaggtgaggatgaaactcaagtaaaacaaagagttgcctcttggttatttattaaatac
tttttagtatatatgcttgaacgtgaagatagaacatcaatgtctcaatcattagaagtt
cgtgtaccttattgtgattataatttggttgaatattgttggaacataccatacaatatg
aaatcaattgatgatattgaaaaaggtattttacgtcgttcaatggctcaacaattacca
aaagatattttatatcatacaaaggataatttcccattatcagttaaagatacaaatttc
tttatttcagtttgtagtctattggaaattgaattaaataatccatcctcaccaatttta
aattttattaaaaaggaatcaattatggaaattattaaaaataaatatgatgaaaaatat
caaacctatcaaaatcaaagtgttattgaacatttacttcaagtaaatacatggatcatt
gattataatgttaaatttgtttaa

DBGET integrated database retrieval system