KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275537Help
Entry
DDB_G0275537      CDS       T00245                                 

Gene name
cytC
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DDB_G0275537 (cytC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 113 aa AA seqDB search
MSDIIARGNVENGDKLFKARCAQCHTTANGAPNKQGPNLYGLFFPKSRSFPGYAYSDPNK
NTGKFCIMWGEQTLFDYLENPKKYIPKTKMAFAGFKSEQDRADVVAYLEQSTK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattattgcaagaggtaacgtcgaaaacggtgacaaacttttcaaagcaaga
tgtgctcaatgtcacaccactgctaatggtgcaccaaacaaacaaggtccaaatctttac
ggtttattctttcctaaatcacgttccttccctggttatgcctactctgaccccaacaaa
aacactggaaagttttgtatcatgtggggtgaacaaactctctttgattacttagaaaat
ccaaagaaatacattccaaagactaaaatggcctttgctggtttcaaatctgaacaagat
agagctgatgttgtcgcttaccttgaacaatcaactaaataa

DBGET integrated database retrieval system