KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275619Help
Entry
DDB_G0275619      CDS       T00245                                 

Gene name
pppB
Definition
protein phosphatase 1, catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    DDB_G0275619 (pppB)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     DDB_G0275619 (pppB)
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     DDB_G0275619 (pppB)
Transcription machinery [BR:ddi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     DDB_G0275619 (pppB)
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     DDB_G0275619 (pppB)
Spliceosome [BR:ddi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    DDB_G0275619 (pppB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 321 aa AA seqDB search
MEIDLDSIITRLLEPRTTKPGKLVDLAEEEIRYLTVQATEIFINQPILLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPQSNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGN
HECASINRIYGFYDECKRRYNSKLWKAFTDCFNCLPVAAIIDEKIFCMHGGLSPDLKNMD
QIRRITRPTVVPDFGLLCDLLWADPDKNIQGWEDNDRGVSYTFGADVVESFLKKHDLDLV
CRAHQVVEDGYEFFAKRQLVTLFSAPNYFGEFDNAGAMMGVDETLMCSFQILKPADKKKL
TNDSNGRPLTPPRNKQQKPKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgatttagattcaatcattacaagattattggaaccaagaactacaaaacca
ggtaaattagttgatttagcagaggaggaaattagatatttaacagttcaagccactgaa
atctttataaatcaaccaattttattggaattagaagcaccaatcaagatctgtggtgat
attcatggacaatactacgatttacttcgtctctttgagtacggaggattcccaccacaa
agtaattatctttttttaggtgattatgtcgatcgtggtaagcaatccttagagaccatt
tgtttattgttggcctataaaatcaaatatccagagaactttttcattcttcgtggaaat
cacgaatgtgcatccatcaatcgtatctatggtttttacgatgaatgcaagagaagatac
aacagcaaattatggaaagcatttacagattgcttcaactgtctcccagttgcagccatc
attgacgagaaaatcttttgtatgcatggtggtctctcaccagatctcaagaatatggat
caaattcgtagaatcactagaccaaccgttgttccagattttggtcttttatgtgatctc
ttgtgggctgatcctgataaaaacattcaaggttgggaagataatgaccgtggtgtctcc
tatacttttggtgccgacgttgtcgaatcattcttaaagaaacacgatctcgatttagtt
tgtagagctcatcaagttgtagaagatggttatgaattctttgctaaacgtcaattggta
accctcttttccgctccaaattactttggtgaatttgataacgctggtgctatgatgggt
gtcgatgaaactttaatgtgttcattccaaattttaaaacctgccgataaaaaaaaactt
acaaacgatagtaatggtagaccattaactcctccaagaaataaacaacaaaaaccaaaa
aaataa

DBGET integrated database retrieval system