KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275663Help
Entry
DDB_G0275663      CDS       T00245                                 

Gene name
bpnt1
Definition
3',5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Sulfur metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DDB_G0275663 (bpnt1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     DDB_G0275663 (bpnt1)
Transfer RNA biogenesis [BR:ddi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    DDB_G0275663 (bpnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 311 aa AA seqDB search
MSKTLNILELTSACIKLAQESGDIIRDVFKSGSLGIEMKSVDDPMTKADLLSQQHIIGSL
RTIWSDIKIVGEEQCEIPTIDKKPPIDLLANDKDCIEKCPEEFKQLPIDDLIIFIDPLDA
TREFTLGRVGCVMTLIGISFKGKPIAGIIYQPFVDCNGDGTTDQSKWVGRTIWAIVGGGI
PVKGIKDRRAPEDVGKVILTTTASHFNDKVQQAVDAIKPDKLLRAGGAGYKSLLVIENQA
DVYVFPTVGSKLWDICGPHAILLAVGGKLTDPQGNDIIYSTDPEKIENKNGIIITISNHQ
KYIDLLKNFKN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaactttaaatatattagaattaacatcagcatgtataaaattagcacaagaa
tcaggtgatataataagagatgtttttaaatcaggatcattaggaattgaaatgaaatca
gttgatgatccaatgacaaaagcagatttattatcacaacaacatataattggttcattg
agaactatttggagtgatattaaaatagttggagaggaacaatgtgaaataccaacaatc
gataagaaaccaccaattgatttattagcaaatgataaagattgtattgagaaatgtcca
gaagaattcaaacaattacccattgacgatttaatcattttcatcgatccattagacgca
actagagaatttacattgggtagagtgggttgtgtgatgacattaattggaattagtttc
aaaggtaaaccaattgcaggtatcatttatcaaccatttgtagattgtaatggtgatgga
acaactgaccaatctaaatgggtgggaagaacaatttgggctattgtcggtggcggcata
ccagttaagggaatcaaagatagaagagcacctgaagatgttggtaaagtgattttaaca
accaccgcctctcatttcaatgataaagttcaacaagctgtagatgcaattaaacctgat
aaattattaagagctggtggtgctggttataaaagtttattggtaattgaaaatcaagca
gatgtttatgttttcccaactgttggttcaaaactttgggatatctgtggtccacatgct
atcctattagctgttggtggtaaattaactgatcctcaaggtaatgatattatttactca
accgatcctgaaaaaattgaaaataaaaatggtataatcattacaatatcaaatcatcaa
aagtatattgatttattaaaaaattttaaaaattaa

DBGET integrated database retrieval system