KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276141Help
Entry
DDB_G0276141      CDS       T00245                                 

Gene name
pdi1
Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DDB_G0276141 (pdi1)
Enzymes [BR:ddi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DDB_G0276141 (pdi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 363 aa AA seqDB search
MKILLFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLAPD
FEILADTFAPVSNKVVIAKVDCDQADNKALCSKYDVSGYPTLKIFDKSTTAKDYNGARSV
DELLTYINNHAKTNVKVKKAPSNVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMP
DYEILGNTYANEKDVVIAKIDCDAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRD
LDTFINYINKQAGVNRVKGGKLAVGAGRVEQLDTIATEFIAAAAEVRKELVKKAQTVVDS
LPEELRTEGSYYVKVMKTIAEKSIDFVTTEIARITKLVSGSMSGKKADEFAKKLNILESF
KSK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattattatttgttacattaattgcattggcatttgttgccttatgctcagca
gaaggaaatgttgttgttttatcaccagacaactttgatacagttgttgatggttcaaaa
actgtatttgtaaaattctatgcaccatggtgtggccattgtaaaaaacttgcaccagat
tttgaaatccttgctgacacattcgcaccagtttccaacaaagttgtaattgccaaagtt
gattgtgaccaagctgacaacaaagctctctgtagtaaatatgatgtttctggttatcca
accctcaaaatctttgacaaatcaaccactgccaaagattacaacggtgctagatcagtt
gatgaattattaacttatatcaataatcacgccaaaaccaacgttaaagtaaagaaagca
ccatcaaatgttgttgatttatcaccatcaaattttgattcagttgttttagataaatca
aagaatgttttagttgaattctatgcaccatggtgtggtcattgcaaaaagttaatgcca
gattatgaaatccttggtaacacctacgccaatgaaaaagatgttgtcatcgccaaaatt
gattgcgatgctgctgataacaaagccatctgctccaaatatggtgtcactggtttccca
acactcaaatggttcggtaaacaaagcaaagacggtgaaaaatatgaacaaggtcgtgat
cttgatactttcatcaactacatcaacaaacaagctggtgttaaccgtgtcaaaggtggt
aaactcgctgttggtgctggtcgtgttgaacaactcgatactattgccactgaattcatc
gctgccgctgctgaagtccgtaaggaactcgtcaagaaagctcaaaccgtcgttgattct
ctcccagaagaattaagaactgaaggttcatactacgtcaaagtcatgaaaaccattgct
gaaaaatcaatcgattttgtaaccactgaaatcgctcgtatcaccaaattagtctctggt
tcaatgtctggaaagaaagctgatgaatttgccaagaaactcaatattttagaatctttc
aaatcaaaataa

DBGET integrated database retrieval system