KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276321Help
Entry
DDB_G0276321      CDS       T00245                                 

Definition
AMP-dependent synthetase and ligase domain-containing protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ddi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ddi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ddi00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 637 aa AA seqDB search
MSFPQKLNRLFFNSGVIIQTPKQKQLILNSIKLKTNSSCSSKTLLINNNKNNNNNNIYNK
RFYSSTTPYEFLDRNLNKVQNLKNYEEAYKSFKWDIPEYFNIGQEICDKHANDPNKMNHI
AIKHIIDEDKNISKEYTFKDLQTKSNQLANKYKEIGLKKRDRVGVLLSQGFECALSHTTT
LRSGMITMPLFTLFGPEALEFRLSNSSTSCVLTDLENLEKLLGILPCLPNLKKIIVFGTL
SENFKNNSHYGNLIEEWNDKISENYSKEFEAIKSKSDDEAVIIFTSGTTGNPKGCLHAHR
VLLGHLPGVQFPQNNFPNRKSTNDYIFYTPADWAWIGGLFDVLIPSLYYGVTVLAHRMTK
FEPKKICKLLIDNKVDTAFLPPSALKIMKQQEEQLKLTPVNMTSIGSGGESLGEKLLQWG
KEQFNVEIAEFYGQTEANLLVGNCPSVFPIKNGSIGKPIPGHIVEIIDSNGMILPIDQVG
DIALKTPDPVAFLTYWNNDKAAKKKMNGDWLVTGDLGRKDSDGYIWYVGRDDDIINSSGY
RIGPSEIENCLLKHPSVSNVGVVGVPDEIRGEIVKAFIVLNPSYSKSDQLKKDIQNYVKT
ILSAHEYPREIEFINELPTTTTGKIIRKDLRSLHNKK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcctcaaaaactaaacagattattctttaatagtggagttattatacaaaca
ccaaaacaaaaacaactaatactaaattctataaaattaaaaacaaattcatcatgttca
tctaaaacattattaatcaataataataaaaataataataataataatatttataataaa
agattttattcatcaacaacaccttatgaatttttagatagaaatttaaataaagttcaa
aatttaaaaaattatgaagaggcctataaatcattcaaatgggatataccagaatatttt
aatattggccaagaaatttgtgataaacatgcaaatgatccaaataaaatgaatcatata
gcaattaaacatataattgatgaagataaaaatatatctaaagaatatacatttaaagat
ttacaaactaaatcaaatcaattagcaaataaatataaagagattggattaaagaaaaga
gatagagttggagttttattatcacaaggatttgaatgtgcattatcacatacaacaaca
ttaagatctggtatgattacaatgccattattcacattatttggtccagaagcattagaa
tttagattatcaaattcttctacaagttgtgtattaacagatttagaaaatcttgaaaaa
ttattaggaattttaccttgtttaccaaatttaaaaaaaattatagtatttggtacatta
tctgaaaattttaaaaataattcacattatggtaatttaattgaagaatggaatgataaa
attagtgaaaattattcaaaagaatttgaagcaattaaaagtaaatcagacgatgaagca
gtaattatatttacatcaggtacaacaggtaatccaaaaggatgtttacatgcacataga
gttttattaggacatttaccaggtgtacaatttccacaaaataattttccaaatagaaaa
tcaacaaatgattatattttttatacaccagcagattgggcatggattggtggattattt
gatgtattaattccaagtctttattatggtgtaactgtattagctcatcgtatgactaaa
tttgaaccaaaaaagatttgtaagctattgattgataataaagtagatacagcattttta
ccaccatcagcgttgaaaattatgaaacaacaagaggagcaattaaaattaacacctgtt
aatatgacatcgattggaagtggcggtgaaagtttaggtgaaaaactattacaatggggt
aaagaacaattcaatgttgaaattgcagaattctatggtcaaaccgaagcaaatctattg
gttggtaattgtccatcagtttttccaatcaagaatggttcaattggtaagccaatacct
ggacatatcgttgaaattattgattcgaatggtatgattttaccaattgatcaagttggt
gatattgctttgaaaacaccagatccagttgcatttttaacttattggaataatgataaa
gctgctaaaaagaaaatgaatggtgattggttagtaactggtgatttgggtagaaaagat
agtgatggttatatttggtatgttggtagagatgatgatataatcaattcaagtggttat
cgtattggtccttcagaaattgaaaattgtttattaaaacatccttcagtttcaaatgtt
ggtgtggtaggtgtacctgatgaaattcgtggtgaaatagtaaaagctttcattgtttta
aatccttcctattctaaatctgatcaattaaaaaaagatattcaaaattatgtaaaaaca
atattatctgctcatgaatatccaagagaaattgaattcattaatgaattaccaactact
acaactggtaaaataattcgtaaagatttaagatcattacataataaaaaataa

DBGET integrated database retrieval system