KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276335Help
Entry
DDB_G0276335      CDS       T00245                                 

Gene name
pyr1-3
Definition
aspartate carbamoyltransferase
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ddi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ddi00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 2225 aa AA seqDB search
MDILNRKKGCLVLEDGTKLSGYSFGSERSVAGECVFSTGMVGYNESISDPSYTGQILVFS
FPLIGNYGVPSFRERDPESGLAVNFESDKAHVQAIICSEYCDEYSHWAAEKSLSEWLKES
NIPGLYGIDTRALITKIREKGSLKGKVIIGDFDESKLEFEDINLRNLVAEVSTKEIKEYK
AAENNKKTGEKRKNKKVIVLDCGIKNNQIRCLLNRGVDLKVVPWDYDVVANESINDYDGV
FISNGPGDPSLCGKAIENIRKVLALPVAKAVFGVCMGNQLLGLAAGAQTHKMAFGNRGLN
QPCVDQISGRCHITSQNHGFVIDSNSLPAGSGWKTYFINANDASNEGIYHESKPWFSVQF
HPEAMAGPTDTEYLFDNFVDNVCGEQQHKSPMNKSKIIDCPKGINKVLILGSGGLSIGQA
GEFDYSGSQAIKALKEEGIKTILINPNIATVQTSPGLADKVYFLPVNASSVQKVIENENP
DGILVTFGGQTALNCGIELYKSGILEKYNCKVLGTPIETIIATEDRGIFAEKLSEINERI
APSMACNSLEESLIEAEKIGYPVIVRAAYCLGGLGSGFADNKEQLTALVTEAMATSSQVL
VEKSLKGWKEIEYEVLRDSKDNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLR
ETAIKTVRHLGVIGECNIQYSLNPYSEEYCIIEVNARLSRSSALASKATGYPLAFISAKV
ALGYDLAALRNTITKKTTACFEPSLDYLVVKMPRWDLKKFTRVSNKISSSMKSVGEVMSI
GRKFEEAIQKAIRMVMDGAVEGFQAGVFPTSDEELEHPTNNRILVLASAFKDGYSIDRVH
QLTKIDKWFLTKLKAIIDLENHLSTYKEPSQIPSEILKFSKQQGFSDKQIARAVGTTELN
VRDYRKKMGIIPCTKHIDTVAAEFPAQNNYLYMTYNGETNDVNINEKSYITLGSGSYRIG
SSVEFDWCAVSCIRTLRSLGLKSIMINFNPETVSTDYDECDYLYFEELSLERVLDIYERG
GPNSNHGVILSVGGQIPNNLAIPLSRCNVKVLGTHPDMIDSAENRYKFSRLLDTIGIDQP
LWKELTSVSDTKDFCESVGFPCLVRPSYVLSGAAMNVVHSSQDLETFLTEAAAVSRDHPV
VISKFIQEAKEIEIDAVADNGRIVLFAISEHVENAGVHSGDATIVCPAQDLDDATILKVE
ETARKIAEALNVSGPFNIQFIAKNNEIKVIECNLRCSRSFPFVSKTLNINFIELATKIII
KHQYDLPVVNPINYVGVKVPQFSFIRLKGADPVLGVEMASTGEVACFGNTREEAYVKGLI
STGFKAPEKNVLLSIGSFKEKHEFLPSAHKLIKLGYTLFGTQGTADFYSENGVPVTQLNW
DEEDLGENVIQKKMTENTIHLFINLPSKNKYRRPSSFMSRGYSLRRVAIDFQVPLITNIK
CAKLFVDSLSYMKGPMPIENVDWRTSNKIIRLPGLVDVHVHLREPGATHKEDWDSGTATA
LAGGFTMVGAMPNTNPAIMDDASFELCKSLAASKARCDYGIFIGATFTNTTTAGKFASDA
MGMKMYLEETFAPLPLKDDINVWRDHIMNWPGTTPICVHADGRNLAAILLLGWMYDKHMH
VCHVSHKEEIDIIRDAKKRGMKLSCEVSPHHLTLCDKDIPRIGAGQSEVRPKLGTEEDLN
ALWDNIDYIDMIATDHAPHTWEEKCSAKPPPGFPGLETSLPLMLTAVHNGRITIEDLVMK
MHTNPIRIFNLPEQPDTYIEVDMEQEWTIPKKPLYSRCGWTPFEGLQVRGKVVKVVLRGQ
IAFIDGKIIAQKGFGLNLRSKEYQVEKERLLNTTKPIYDKIPTVQSTKNQTTNITSPSLI
SDSPNKAINKIKSTSTSTTPNTQEQSTQHLPLVGSNLASAVLNKKEDTLQTAFNISDNSL
AGKHIFSVKQFNRKQLHALFGIAHEMRILVKRSGGSDLLKGKVLATLFYEPSTRTQCSFT
AAMQRLGGSVVTVDNVSSSVAKGESIADTIQTLESYCDAVCMRHPAVGSVESAIQVAKKP
IINAGDGVGEHPTQALLDVFTIREELGTVNGLTITVVGDLKHGRTVHSLVRLLANYQVKI
NYVSPSSLSMPTEIIKELNEKGIEQKEYTNIESILPTTNVLYVTRVQKERFQSIEEYEKV
KDSFIITPHTLTKASDNMIVMHPLPRINEISPEVDSDPRAAYFRQMENGLYVRMSLLALV
FGAGV
NT seq 6678 nt NT seq  +upstreamnt  +downstreamnt
atggatattttaaatagaaaaaaaggttgtttagtacttgaggatggtactaaattaagt
ggttactcatttggaagtgaaagatctgttgcaggtgaatgtgttttttcaactggtatg
gttggttataatgaatcaatttcagatccatcatatactggacaaattttagtattctca
tttccattgattggtaattatggtgtaccatcatttagagaaagagatccagaatcagga
ttagcagtaaactttgaatcagataaagcacatgttcaagcaattatttgttcagagtat
tgtgatgaatattcacattgggcagcagagaaatcactttcagagtggttaaaagaatca
aacattccaggtttgtacggaatcgatacacgtgctttgatcaccaaaattcgtgagaag
ggctctctaaaaggaaaggtaatcattggtgactttgatgaaagtaaattggagtttgaa
gatattaatttacgtaatttggttgcagaagtttcaaccaaagagattaaagaatacaaa
gctgcagagaacaataagaaaactggcgaaaaaagaaagaataaaaaagtgatcgtactt
gattgtggtattaaaaataatcaaatccgttgtttattaaatcgtggtgtagatcttaaa
gttgtaccatgggactacgatgtggttgcaaacgaatcaatcaatgattacgatggtgtt
ttcattagtaatggtccaggtgatccaagtctttgtggaaaagcaattgaaaacattaga
aaagtattggcattgccagttgccaaagcagtatttggtgtttgtatgggtaatcaattg
ttaggtttagccgctggtgcacaaactcataaaatggcctttggtaatcgtggtctcaat
caaccatgtgtcgatcaaattagtggccgttgtcatatcacctcacaaaatcatggcttt
gttatcgattcaaattctttaccagctggtagtggttggaaaacttactttataaatgca
aatgatgcctccaacgaaggtatctatcatgagagtaaaccatggttctctgttcaattc
catccagaagctatggcaggtccaaccgatactgaatatcttttcgataatttcgttgat
aacgtttgtggtgaacaacaacataaatcaccaatgaataaatctaaaatcatcgattgt
ccaaaaggtatcaataaagttttaattttaggttcaggtggtctttcaattggtcaagct
ggtgaatttgattattctggttctcaagctatcaaagcactcaaagaagaaggtattaaa
accattttaattaatccaaatatcgcaacagttcaaacttcaccaggtcttgccgataaa
gtttatttccttccagttaatgcttcctctgttcaaaaagtaattgaaaatgaaaatcca
gatggtattttagtaacttttggtggtcaaacagctttgaattgtggtattgaactctat
aaatctggtatactcgagaaatataattgtaaagtattgggtactccaattgaaactatc
attgccactgaagatagaggtatctttgcagagaaattatcagaaatcaatgaacgtatc
gcaccatcaatggcttgtaatagtttagaggaatctttgattgaagcagagaaaattggt
tatccagtcattgttagagctgcctattgtttgggtggtttaggttctggtttcgccgat
aataaagaacaactcacagcattggtcactgaagcaatggcaacctcttcacaagttttg
gttgaaaaatcactcaaaggttggaaagaaattgaatatgaagttttaagagatagtaaa
gacaattgtatcaccgtttgtaatatggaaaatttcgatccactcggtattcatactggt
gaatcaatcgtcgttgcaccatcacaaacactttcagatagagaatatcaaatgttaaga
gaaactgcaattaaaaccgttcgtcatcttggtgtaattggtgaatgtaatattcaatat
tccctcaatccatatagcgaagaatattgtatcattgaagttaatgcacgtctttcacgt
agttcagcattggcaagtaaagcaaccggttatccacttgctttcatctctgccaaagtt
gctttgggttatgatttagcagcattaagaaatacaatcacaaagaaaactacagcatgt
ttcgaaccttcattggattatttagttgttaaaatgccacgttgggatttaaagaaattc
actcgtgtttccaataaaatttcatcatcaatgaaatcagttggtgaagttatgtcaatt
ggtagaaaatttgaagaagcaattcaaaaagcaattagaatggttatggatggtgcagtt
gaaggtttccaagctggtgttttcccaacctctgatgaagaacttgaacatccaactaat
aatcgtattttagtattggcaagtgctttcaaagatggttattccattgatagagtacat
caattaacaaagattgataaatggttcttaacaaaacttaaagcaatcatcgatttagag
aatcatttatcaacctataaagaaccatcacaaattccatcagagattttgaaattctca
aaacaacaaggtttctctgataaacaaatcgccagagcagttggtaccacagaattgaat
gttagagattatagaaagaaaatgggtatcattccatgtacaaaacatatcgatacagtt
gctgcagaattcccagctcaaaacaattatctttacatgacttacaatggtgaaaccaat
gatgtaaatatcaatgaaaaatcttatatcacattaggttcaggttcatatcgtattggt
agtagtgttgagtttgattggtgcgcagttagttgtattcgtacattacgtagtttaggt
ttgaaatcaattatgatcaatttcaatccagagactgttagtactgattatgatgaatgc
gattatctctactttgaagaactctcattggaaagagtattggatatctatgaacgtggt
ggtccaaattcaaatcatggtgtaatattatcagttggtggtcaaattccaaacaattta
gccattccattatcacgttgtaatgttaaagttttaggtactcatccagatatgattgat
tcagctgaaaatcgttataagttctcacgtcttttagataccattggaattgatcaacca
ctttggaaagaattaacaagtgtttccgatacaaaagatttctgtgaatctgttggtttc
ccatgtttagttcgtccatcttatgtactctctggtgctgctatgaatgtagttcactct
tcacaagatctcgaaacattccttactgaagctgctgcagtttcacgtgatcatccagtt
gtcatttcaaaattcattcaagaagctaaagagattgaaattgatgctgtcgccgataat
ggtcgtattgttttattcgcaattagtgaacatgttgaaaatgccggtgtacacagtggt
gatgctaccattgtttgtccagctcaagatcttgatgatgccaccatcctcaaggttgaa
gaaaccgctagaaagatcgctgaagcactcaatgtcagtggtccattcaatattcaattc
attgctaaaaacaatgaaatcaaagttatcgaatgtaatttacgttgttcacgttctttc
ccattcgttagtaaaacattaaatatcaattttatcgaattagcaactaaaatcatcatt
aaacatcaatatgatcttccagttgtaaatccaatcaattatgttggtgtcaaagtacca
caattctcattcattcgtcttaaaggtgcagatccagttttaggtgtagaaatggcatcc
actggtgaggtagcatgttttggtaatactcgtgaagaagcttacgtcaagggtttaatt
tctactggtttcaaagcaccagaaaaaaatgtactcctttcaattggttcattcaaagag
aaacatgaattccttccatcagctcataaattaattaaattaggttataccttatttggt
actcaaggcactgccgatttctacagtgaaaatggtgttccagtaactcaactcaattgg
gatgaagaggatttaggtgaaaatgtaattcaaaagaaaatgactgaaaatacaattcat
ctcttcattaatttaccatcaaagaataaatatcgtcgtccatcttcattcatgtcaaga
ggttattcattacgtcgtgttgctatcgatttccaagtaccactcattaccaacatcaaa
tgtgctaaattattcgtcgattctttatcctacatgaaaggtccaatgccaattgaaaat
gttgattggagaacaagtaataagatcattcgtttaccaggtttagttgatgttcatgtt
catcttagagaaccaggtgccactcataaagaagattgggacagtggtacagcaactgca
ttagctggtggtttcaccatggttggtgctatgccaaacactaatccagccattatggat
gatgcatcatttgaactttgtaaatcattggcagcctcaaaagcacgttgtgattatggt
attttcattggtgccacttttaccaatacaacaaccgctggtaaattcgcatccgatgcc
atgggtatgaaaatgtatctcgaagaaacctttgctccacttccattaaaagatgatatc
aacgtttggagagatcatattatgaattggccaggtacaacaccaatttgtgttcatgct
gatggtagaaatcttgcagcaattctcttattaggttggatgtatgataaacatatgcat
gtttgccacgtttcacataaagaagagattgatattattcgtgatgcaaagaaacgtggt
atgaaattatcatgtgaagtttcaccacatcatttaaccctttgtgataaagatattcca
cgtattggtgctggtcaatctgaagttcgtccaaaacttggaactgaagaagatttgaat
gcactctgggacaatatcgattacattgatatgattgcaaccgatcatgctccacacact
tgggaagagaaatgtagcgccaaaccaccaccaggtttcccaggtcttgaaacttcatta
ccattgatgttaactgccgtccataatggtagaatcaccattgaagatttggtaatgaaa
atgcacacaaatccaattcgtattttcaatcttccagaacaaccagatacttacattgaa
gttgatatggaacaagaatggaccattccaaagaaaccactctattcaagatgtggttgg
actccattcgaaggtcttcaagtacgtggtaaagttgttaaagtcgtacttcgtggtcaa
atcgctttcattgatggtaaaatcattgcacaaaaaggttttggtttaaatttacgttca
aaagaatatcaagttgaaaaagaaagattactcaatactaccaaaccaatttatgataaa
atcccaactgttcaatcaacaaagaatcaaactacaaatattacttcaccatcattaatt
agtgattcaccaaataaagccatcaataagattaaatctacttccacttctacaactcca
aatactcaagaacaatcaacacaacatttaccattagttggatcaaatcttgcatcagct
gtattaaataaaaaagaagatacactccaaactgctttcaatatctcagataattcattg
gcaggtaaacatattttctcagttaaacaattcaatagaaaacaattacatgccttattt
ggtattgctcatgaaatgagaattttagttaagagatcaggtggttcagatttattgaag
ggtaaagttttagctactctcttctatgaaccaagtactcgtactcaatgttcattcact
gctgccatgcaaagattaggtggttcagttgtcactgttgataatgtatcatcatcagtt
gccaaaggtgaatcaatcgctgataccattcaaactttagaatcctattgtgatgcagtt
tgtatgagacatccagctgttggttcagttgaaagtgcaattcaagtcgccaaaaaacca
atcattaacgcaggtgatggtgttggtgaacatccaactcaagctttattggatgttttc
acaattcgtgaagaattaggtaccgtcaatggtttaactatcaccgttgttggtgatctt
aaacatggccgtaccgttcattctttggttcgtctcttagcaaactatcaagttaaaatc
aattatgtctcaccatcttcactctcaatgccaactgaaatcatcaaagaactcaatgaa
aaaggtattgaacaaaaagaatatacaaatatcgaatctatccttccaactaccaatgta
ctatatgtaactagagttcaaaaagaacgtttccaaagtattgaagaatatgaaaaagtt
aaagattctttcattatcactccacatactctcactaaagcttctgataatatgatcgtt
atgcatccacttccaagaattaatgaaattagtccagaagttgattctgatccacgtgct
gcttactttagacaaatggaaaatggtttatatgtccgtatgtcacttttagctcttgta
tttggtgctggtgtttaa

DBGET integrated database retrieval system