KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0276337Help
Entry
DDB_G0276337      CDS       T00245                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase domain-containing protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00620  Pyruvate metabolism
ddi00640  Propanoate metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0276337
   00620 Pyruvate metabolism
    DDB_G0276337
   00640 Propanoate metabolism
    DDB_G0276337
Enzymes [BR:ddi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DDB_G0276337
Lipid biosynthesis proteins [BR:ddi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DDB_G0276337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 8620448
NCBI-ProteinID: XP_643176
dictyBase: DDB_G0276337
UniProt: Q8SSN6
Position
2
AA seq 596 aa AA seqDB search
MENNKPYKFIDRNLNIIKKSGSYENIYKSFKYEIPEYFNIGLEVCDYYANDPNKMNNIAI
KHIYDTDDKQILKEYTFKEIKIKSNQLANKFKEIGLNKKGEVVGVFLTQGIECALSHITI
LRSGFIGLLLSVLFGPEALEYRISSSSASCVITDLDNIHKLLKVVPNLPSLKKIIVFGDN
LNSINYSKHKNIVELWNENICNNYSKEFEPIITKSNEPAYLIYTSGTTGLPKGCLHAHRV
LIGNNVGLQFTLNLFPQNTVSVTENCYYSPADWAWIGGLLVVFLPSLYFGVPLLAYKSKG
PFDAKKLLTLVKTHNVTMSFLPPSALKMIKFQKDQLKDHKINNMLAINSGGESLGENLLV
WSKDQFGVEVAEFIGQSEGNFITGNCLDLFPPKNGSMGKPIPGSNVRILNDNGERVPHDE
VGYLCIEFTGDNANQFLGYWNDPSSTEKRMIFSKESGTKWIKTGDLAKEDSDGYFWYIGR
DDDVINSSGYRIGPNEIEGCLLKHPLILNVAVIGIPDEIRGEVVKAYIVLNQSVTPSQEI
KKEIQNYVKTQLSAHQYPREIEFINPNEMPITTTGKIMRNSLRQLHKMKSNNKSKI
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataataaaccttataagtttatagacagaaatttaaatatcattaaaaaaagt
ggtagttatgaaaatatttataaatcatttaaatatgaaataccagaatattttaatatt
ggtttagaagtttgtgattattatgcaaatgatcctaataaaatgaataatattgcaatt
aaacatatttatgatactgatgataaacaaattttaaaagagtatacatttaaagaaatt
aaaattaaatcaaatcaattggcaaataaatttaaagaaattggtttaaataaaaaaggt
gaagttgttggtgtttttttaacacaaggaattgaatgtgctttatcacatattacaata
ttaagaagtggttttattggattattattatcagttttatttggaccagaagctttagaa
tatagaatttcatcatcatcagcttcatgtgttatcactgatttagataatattcataaa
ctattaaaagtagttccaaatttaccaagtttaaagaaaattattgtatttggtgataat
ttaaattcaattaattattcaaaacataaaaatattgttgaattatggaatgaaaatatt
tgtaataattattcaaaagaatttgaaccaattataaccaaatcaaatgaaccagcatat
ttaatatatacatcaggtacaactgggttgccaaaaggatgtttacatgcacatagagta
ttaattggtaataatgttggattacaattcacattgaatctattccctcaaaatacagta
tcagtaacagagaattgttattattcacccgctgattgggcatggattggtggattatta
gtagtgtttttaccatcattatattttggtgtacctttgttagcatataaatcaaaaggt
ccatttgatgcaaagaaattattaacactagtgaaaactcataatgtaacaatgtcattc
ttaccaccatctgcattgaaaatgataaagtttcaaaaggatcaattaaaagatcataaa
attaataatatgttggcaatcaatagtggtggtgaaagtttaggtgagaatttattagtt
tggtcaaaagatcaatttggtgttgaagttgctgaatttattgggcagagtgaaggaaac
ttcattactggtaattgtttagatttattccctccaaagaatggatcaatgggtaaacca
ataccagggagcaatgtcagaatattaaatgataatggtgagcgagtacctcacgatgaa
gttggttatttatgtatagaatttacaggtgataatgcaaatcaattcttaggttattgg
aatgaccctagttcaacagagaaaagaatgattttctcaaaagaaagtggtaccaaatgg
ataaaaactggtgaccttgcaaaagaggatagtgatggctacttttggtatattggtaga
gatgatgatgttattaattcaagtggttatcgtattggtccaaatgaaattgaaggttgc
ctactaaaacatccattaattttaaatgttgctgttattggtatacctgatgaaattcgt
ggtgaagttgtaaaagcatatattgttttaaatcaatcagtaacaccttcacaagagata
aaaaaagaaattcaaaattatgttaaaactcaattatcagctcatcaatatccaagagaa
attgaatttataaatccaaatgaaatgccaatcacaacaactggtaaaattatgagaaat
tcattaaggcaattacataaaatgaaaagtaataataaatcaaaaatttaa

DBGET integrated database retrieval system