KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277221Help
Entry
DDB_G0277221      CDS       T00245                                 

Gene name
chcA
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    DDB_G0277221 (chcA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Proteins found in most exosomes
   DDB_G0277221 (chcA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 1694 aa AA seqDB search
MTNLPIRFQEVLQLTNLGIGSNSIGFSTLTMESEKYICIRETTPDDKNNVVIIDTDNPSQ
ILRKQMKTDAAIMNPKEPILALKIGQVLQLISIEQKMQLKSCQMQEPLEFWKWISPNTLA
LVTATSVFHWTKEGNSDPVKVFDRHPDLQNTEIINYRSDSTQNWLVLVAIHQRDGRVVGR
IQLYSVEKQISQSIEGHAACFANYIVPGATRPSTLFAISSRTQNASKILVLEVSKGDGPN
FQKRASDVFYPPEIGASDFPVAMQVSEKYEVIYMVTKLGYIHLFDLGTANLIYRNRISNE
NIFVTAFEESTNGIIAVNRKGQVLSVSIDDKNIIPYICNTLNNLELAISMACKNNLPGAE
GLLTTQFERYFQQGQYKEAAKVAADSPGSILRNLQTIQKFQSIPPIPDQPSALLQYFGML
LEKGKLNKVESLELVRPVLAQGKKPILEKWLTEDKLECSEQLGDEVRPHDRKLALSIYYR
ANASDKVITLFAETGEFDKIIAYCKKFNYKPDFMFLLQRMANANPMGAADFAVKLVKEEG
GPYIDANQVVELFSARNMIQETSNFLFAILDGDRPQDANLQTKLLEINLLHAPQNADAIM
GGQKFTHYNRLRIGGLCEKAGLYQRALEHYTDLADIKRVLSHAGHMVNQEFLVSYFGSLN
PEDRMECMRDFLRTNPRQNLQLVVAIAVSYSDQITPEAIIAMFESFRLYEGLYLYLTQVV
VTSTSPEVHFKYIEAAAKINQFKEVERMCRDSNYYDPEKTRDFLKEAKLPDQLPLIIVCD
RYEFISDLTNYLYKNNLSKYIEAYVQKINPVNTPLVVGALLDLDCQEDYLRNLIMSVRNM
CPADSLVEQVEKRNRLKLLLPWLEARVAEGNIEPAIHNALAKIYIDSNKNPEAFLLHNQF
YDSKVVGKYCEKRDPYLSFVAYKRGLCDYELIEVTNKNTLFKNQARYLVERQDPDLWAYV
LSDQNEYKRSLIDQVVQTALPESTNATEVSATVKAFMDANLPNELIELLEKIVLEGKEFK
TAKELQNLLILTAIRADKSRVTDYINRLDNFDGSKLAPIAIESQLYEEAFFMYKKFQFNV
EAIDVLITHIGSIERAHDFAERCNQTEVYSKLGVAQLKAEMVKECIESFIKANDTEHYQE
VVAAAERKDEYEDLVKFLQMCRKKIKEPAIESELIFAYAKVNKLAEMEDFINSPNSAHIQ
VVGDRCFENGLYEAAKVLYTNISNFSRLTSCLVKLGQYQAAVDAARKANSTKTWKEVSAA
CIDAKEFRLAQVCGINIIVHGDELEELIRQYEDRGYFNELISLLESGLASERAHVGMFTE
LAILYSKYKEEKLMEHLKLFYSRLNVPKVIKACQANQQWPQLTYLYIHYDEHDNAIQTMI
NHSIEAWDHVLFKETIPKVAKLDLYYSAISFYLEEQPLLINDLLSVLSPRIDHTRAVTLI
RSLGHLPLVKPYLVSAQDQNVAALNEALNELYVEEEDYESLRSSIDANSNFGTIALAQKL
EKHELLEFRRIAAYLYKKNNRWAQSVELSKKDKLYKDAIQSASDSKNPAIGEELLQYFVD
QQNNSAFAACLYTCYDFLKPDAVIELAWRNNILNYSFPYLIQYVKEYTTKVDQLVDDFKA
RQKKTEEEKEQQNIESSQYQPDLTNLSYGYAATGGMLALPPAVGYQQQQQPQQMYNPNQM
MGGFQQNYNQYGGF
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatttaccaattagatttcaagaagttctccaacttacaaatttaggtattgga
tccaattcaattggtttttcaaccttaacaatggagagtgaaaaatacatttgtattcgt
gaaactacaccagatgataaaaataatgttgtaattattgatactgacaatccatcacaa
attcttagaaaacaaatgaaaacagatgctgcaattatgaatccaaaagaaccaatttta
gcattaaaaattggacaagttttacaattaatttcaattgaacaaaaaatgcaattaaaa
tcatgtcaaatgcaagaaccattagaattttggaaatggatatcaccaaatacattagca
ttagttacagcaacatctgtatttcattggacaaaagaaggtaattcagatccagttaaa
gtttttgatcgtcatccagatttacaaaatacagagattataaactatcgttcagatagc
acacaaaattggttagttttagtagcaattcatcaaagagatggacgtgtagttggtcgt
attcaattatactctgtagagaaacaaatcagtcaatccattgaaggtcatgcagcatgt
tttgccaactacattgtaccaggtgcaactagaccatcaacattgtttgcaatttcatca
cgtactcaaaatgcatcaaagatattggtattggaggttagtaaaggtgatggaccaaac
ttccaaaaacgtgcctctgacgttttctacccaccagagattggtgcttccgatttccca
gtggcaatgcaagtctctgaaaagtatgaagtcatctatatggtcactaaattgggttac
attcatctctttgatttgggtacagcaaatctcatctacagaaatcgtattagcaatgaa
aatatatttgtaactgctttcgaagagagcaccaacggtatcattgccgtcaatagaaag
ggtcaagtcttatcggtttcaatcgatgacaaaaacatcattccatacatttgcaataca
ctcaacaatttagagttggccatttcaatggcttgtaaaaacaatttaccaggtgctgaa
ggtttactcaccactcaattcgaacgttatttccaacaaggtcaatataaagaggccgcc
aaagttgctgcagattcacctggctctatcttgcgtaaccttcaaaccattcaaaagttc
caatccattccaccaattccagatcaaccatctgctctccttcaatactttggtatgtta
ttagaaaagggtaaactcaataaagttgaatccctcgaattggttcgtccagttttagct
caaggtaaaaaaccaatccttgagaaatggttaactgaagacaaattagaatgttccgaa
caattgggtgatgaagttcgtccacatgatcgtaaattagcactttcaatctattatcgt
gcaaatgcctctgataaagtgatcactttattcgctgaaactggtgaattcgacaaaatc
atcgcctactgtaagaaattcaattataaaccagactttatgttcttacttcaacgtatg
gcaaatgctaatccaatgggtgccgcagatttcgccgttaaattggttaaagaagaaggt
ggtccatacattgatgccaatcaagtcgttgaacttttctctgctcgtaatatgattcaa
gaaactagtaacttcctctttgccattctcgatggtgatcgtccacaagatgcaaacctt
caaaccaaactcttggagatcaatctcttacatgcaccacaaaacgccgatgccattatg
ggtggtcaaaagtttacacattacaatcgtcttagaatcggtggtctttgcgaaaaagct
ggtctctatcaacgtgccctcgaacattacactgatctcgccgatattaaaagagtttta
tctcatgctggtcatatggtgaatcaagagtttttggttagttattttggttccctcaat
ccagaggatcgtatggaatgtatgcgtgatttccttcgtaccaacccacgtcaaaatctt
caattggttgttgcaatcgccgtttcatacagtgaccaaatcactccagaagcaatcatt
gccatgtttgaatctttccgtctctatgagggtctttatctctacttaactcaagtcgtc
gtaaccagtacctcaccagaggttcattttaaatacattgaagccgccgctaaaatcaat
caattcaaagaggtcgaacgtatgtgtcgtgattcaaactactatgatccagaaaagact
cgtgactttttaaaggaagctaaattaccagatcaattaccattgatcattgtttgtgat
cgttacgaattcatctctgatcttaccaactatctctacaaaaacaatctctccaaatat
atcgaagcctacgttcaaaagattaatccagtcaatacaccattggttgtaggtgcactt
ttggatttagattgtcaagaggactatttacgtaatctcattatgagtgttagaaatatg
tgtccagccgattctttagttgaacaagttgaaaagagaaatcgtttgaaacttttactt
ccatggttagaggcaagagttgccgaaggtaacattgaaccagccattcacaacgctttg
gccaagatttacattgattccaataagaatccagaagctttcctcttacacaatcaattc
tatgatagtaaagtcgttggtaaatattgtgaaaaacgtgatccatacctttcattcgtt
gcctacaaacgtggtttatgtgattatgaattgattgaagtcaccaataagaataccctc
ttcaagaatcaagcacgttatcttgttgaacgtcaagatccagatctttgggcttacgtt
ttatccgatcaaaatgaatacaagagatctctcattgatcaagtcgttcaaaccgctctc
ccagaatcaaccaatgccaccgaagtttctgcaactgtcaaggctttcatggatgcaaac
ttaccaaatgaattgattgaattacttgaaaagattgttctcgaaggtaaagaattcaaa
actgccaaagaactccaaaatcttttaattctcactgctattcgtgccgacaagagtcgt
gtcactgattacattaatcgtttagataactttgatggttcaaaattagcaccaatcgcc
attgaatctcaactctacgaagaagccttctttatgtacaagaaattccaattcaatgtt
gaagctatcgatgttttaatcactcatattggttcaattgaaagagctcatgatttcgct
gaacgttgtaatcaaaccgaggtttacagtaaattgggtgttgctcaattgaaagcagaa
atggtcaaagaatgtattgaatcattcattaaagccaatgatactgaacattatcaagag
gttgtcgctgccgctgaaagaaaagatgaatatgaagatttggttaaattccttcaaatg
tgtcgtaagaagattaaagaaccagccattgaaagtgaattgatctttgcttatgctaaa
gttaacaaattggccgaaatggaagatttcatcaactcaccaaactctgctcacattcaa
gtcgttggtgatcgttgtttcgaaaatggtctctatgaagctgccaaagtactctatacc
aatatttccaacttttcacgtcttaccagttgtctcgtcaaattaggtcaatatcaagct
gccgtcgatgctgcacgtaaagccaactccaccaaaacttggaaagaagttagtgctgct
tgcatcgatgccaaggaattccgtttggcacaagtttgtggtatcaatatcattgtacat
ggtgatgaacttgaagaattaattcgtcaatatgaagatcgtggttatttcaatgaatta
atttccctcttagagagtggtcttgcctctgaacgtgctcatgttggtatgttcaccgaa
ttggctattctctactctaaatacaaagaggagaaattaatggaacacttaaaacttttc
tacagtcgtctcaatgttccaaaggttatcaaagcttgtcaagccaatcaacaatggcca
caactcacctacttatacattcattacgatgaacatgataatgccattcaaaccatgatc
aatcattccattgaagcttgggatcatgttctctttaaagaaaccattccaaaggttgcc
aaattggatctctactatagcgccatctcattctatttagaggaacaaccattactcatc
aatgatctcttatcggttttatcaccacgtatcgatcatactcgtgccgtcactttaatt
cgttcattaggtcatctcccattggttaagccatacttggtatctgctcaagatcaaaat
gtagccgctctcaatgaagctctcaatgaattatacgtcgaagaagaggattatgaatcc
ttgagatcctcaatcgatgccaactccaactttggcaccattgctctcgctcaaaaactt
gaaaaacatgaactcctcgaattccgtagaatcgccgcctatttgtacaaaaagaataat
cgttgggctcaatcagttgaactctctaaaaaagataaactctacaaagatgccattcaa
tctgcctcagactcaaagaatccagccattggcgaagaacttttacaatactttgttgat
caacaaaataatagtgcctttgctgcttgtctttacacttgttacgactttttgaaacca
gatgctgtcatcgaattggcttggagaaataatatcctcaattactcattcccatatctc
attcaatacgttaaagaatatacaaccaaagttgatcaattggtcgatgatttcaaagct
cgtcaaaagaaaactgaagaagaaaaagaacaacaaaatattgaatcctctcaatatcaa
ccagatcttactaacctctcatatggttacgcagccactggtggtatgttagctcttcca
ccagctgtaggatatcaacaacaacaacaaccacaacaaatgtataatccaaatcaaatg
atgggtggtttccaacaaaattataatcaatatggtggtttttaa

DBGET integrated database retrieval system