KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277669Help
Entry
DDB_G0277669      CDS       T00245                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0277669
Enzymes [BR:ddi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     DDB_G0277669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 328 aa AA seqDB search
MYTLEQLQSLWNKGKYIQVLKGNNDLSKLVLKTSTSSCEIYIHGAHITSFKTNSVEHLFM
SEKSGFQDMKAIRGGVPLIWPQFGNGKIQTHGFARNCDWEIHKALVDEKTQSVQIEFLLR
NNEYSEKVWNCNITSGKETINNFHTIYRVTLHPDFLDLEFDVKNTSTSPSSNDNILEFQL
AFHTYYQISNIENVYVLGLDGREYIDKMNGHKITKEVNDKVQISNETDRVYLNVVPTQSI
GKNYQPLQLIDNGSKTSITLTYDYQSMPDVVVWNPWIEKSKKMEDFGDNEYQNMICIEIG
TINTPVKLSPNQSFQTKHSILPSNKSSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtatacattagaacaattacaaagtttatggaataaaggaaaatacattcaagtttta
aaaggaaataatgatttatcaaaattagtactaaaaacatcaacatcatcatgtgaaatt
tatattcatggtgcacatattacatcatttaaaaccaattcagttgaacatttatttatg
agtgaaaaatcaggatttcaagatatgaaagcaattagaggtggagtaccattaatatgg
ccacaatttggaaatggtaaaattcaaacacatggttttgcaagaaattgtgattgggaa
attcataaagcattagttgatgaaaaaactcaaagtgttcaaattgaattccttttaaga
aataatgaatatagtgaaaaagtttggaattgtaatataacaagcggtaaagaaaccatt
aataattttcatacaatctatcgtgtaactttacatccagactttttagatttagaattt
gatgtcaaaaacacctcaacatcaccatcgtcaaatgataatattttagaatttcaatta
gcatttcatacatattatcaaatttcaaatattgaaaatgtttatgttttaggtttagat
ggtagagagtatatagataaaatgaatggtcataagataactaaagaggtgaatgataaa
gtacaaatttcaaatgaaactgatagagtttacttaaatgttgtaccaactcaaagtatt
ggaaagaattatcaaccattacaattgattgataatggtagtaaaacttcaattactcta
acctatgattatcaaagtatgccagatgttgttgtttggaatccatggattgaaaaatca
aagaaaatggaagattttggtgataatgaatatcaaaatatgatttgtattgaaattggt
actatcaatactcctgtaaaattatcaccaaatcaatcattccaaactaaacattcaata
ttaccttcaaataaatcttcattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system