KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277847Help
Entry
DDB_G0277847      CDS       T00245                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DDB_G0277847 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0277847 (pdhC)
   00020 Citrate cycle (TCA cycle)
    DDB_G0277847 (pdhC)
   00620 Pyruvate metabolism
    DDB_G0277847 (pdhC)
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DDB_G0277847 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 635 aa AA seqDB search
MLRAINQNSAKVVKSLKQQLVVLEATNVVAYTGTKSFTTTKTFNNTQTKPKIFTSSNVLS
FSSPSSSNVFSEILNKRSYSSKGKEITMPALSPSMTEGNIVQWKKKEGDQIKAGDVIAEV
ETDKATMDFQYEDGNGYLAKILIPEGTKGIEINKPIAIIVSKKEDIESAVKNYKPSSQAS
STPVQEEAPKPKQEAPKKSTKTYPAHKVVGMPALSPSMETGGIASWTKKEGDQIKAGDAI
AEVETDKATMDFQYEDGNGYLAKILVPGGTSGIQINQPVCIIVKNKEDCDKFADYSVEEQ
SSSSSSSSQESTPSSSSSSSQESTPSQSSSQQTTRKSGERIFATPAARFEASSKGYDLSA
INGTGPNNRILKADVLEFVPQKQEVAQQQQQQTTTTTKKPTTPTSSGEFTDIPHSNIRKV
TAARLTESKQTIPHYYLTMECRVDKLLKLRSELNAMNTVKISVNDFIVKASAAALRDNPV
VNSTWTDQFIRRYHNIDINVAVNTPQGLFTPIVRGVDMKGLNSISTSVKQLAEKAQNGKL
HPSEFESGTFTISNLGMLGIKQFAAVINPPQAAILAVGTTETRVVLSNKPDSPYETATIL
SVTLSCDHRVIDGAVGAEWLKSFKDYVENPIKLIL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagcaattaatcaaaatagtgctaaagttgtaaagtccttaaaacaacaatta
gttgtcttggaagcaacaaatgtagttgcatacactggtactaaatctttcaccacaaca
aaaactttcaacaatactcaaaccaaaccaaagattttcacctcatcaaatgttttatca
ttttcatcaccatcatcatcaaatgttttcagcgaaattttaaacaaacgttcttattca
tcaaaaggtaaagaaattactatgccagcattatcaccaagtatgactgaaggtaatatt
gttcaatggaaaaagaaagaaggtgaccaaattaaagcaggtgatgtcattgcagaagtt
gaaactgataaagcaactatggatttccaatatgaagatggtaatggttatttagctaaa
attttaatcccagaaggtactaaaggaattgaaattaataaaccaattgcaatcattgta
tcaaagaaagaagatattgagtcagcagttaaaaattataaaccaagttcacaagcttca
tcaactccagttcaagaagaagcaccaaaaccaaaacaagaagcaccaaaaaaatcaact
aaaacttacccagctcataaagttgtaggtatgccagcattatcaccaagtatggaaact
ggtggtattgcatcatggacaaagaaagaaggtgatcaaattaaagcaggtgatgcaatt
gctgaagttgaaactgataaagcaactatggatttccaatatgaagatggtaatggttat
ttagcaaagattttagttccaggtggtacatctggtattcaaattaatcaaccagtttgt
attatagtaaagaacaaagaagattgtgataaatttgctgattattcagttgaagaacaa
tcatcatcatcatcatcatcatcacaagaatcaactccatcatcatcatcatcatcatca
caagaatcaacaccatcacaatcatcatcacaacaaactacacgtaaatctggtgaaaga
attttcgctacaccagcagcaagatttgaggcatcatcaaaaggatatgatctttcagca
atcaatggtactggtccaaataatagaattcttaaagctgatgttttagaatttgtacca
caaaaacaagaagttgctcaacaacaacaacaacaaactactaccaccactaaaaaacca
actacaccaacttcatcaggtgaattcactgatattccacatagtaatattcgtaaggtt
actgcagctcgtcttacagaatcaaaacaaaccattccacattattatctcacaatggaa
tgtcgtgttgataaactcttaaaacttcgttcagaattgaatgcaatgaacactgttaaa
atctctgtcaatgatttcattgttaaagcatccgctgccgcccttcgtgataatccagtc
gtaaattcaacatggaccgatcaattcattagaagatatcacaacattgatatcaacgtt
gccgtcaatacaccacaaggtttattcactccaatcgttagaggtgtcgatatgaaaggt
ctcaactctatctcaacctctgttaaacaattggctgaaaaagctcaaaatggtaaatta
cacccatccgaatttgaaagtggtactttcactatctctaacttgggtatgctcggtatt
aaacaattcgcagcagtcatcaatccaccacaagctgctatcttggccgttggtaccaca
gaaactcgtgtcgttttaagcaataaaccagactcaccatatgaaaccgctaccatttta
tccgttaccttaagttgtgatcatcgtgttatcgatggtgctgtaggtgctgaatggtta
aagagcttcaaagattatgttgaaaatccaatcaaattaatcttataa

DBGET integrated database retrieval system