KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277879Help
Entry
DDB_G0277879      CDS       T00245                                 

Gene name
ugpB
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ddi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ddi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 502 aa AA seqDB search
MMKPDLNSPLPQSPQLQAFGSRSSDLATEDLFLKKLEAISQTAPNETVKNEFLNKEIPSI
NKLFTRFLKNRKKVIDWDKINPPPADMVLNYKDLPAITEQRTSELASKLAVLKLNGGLGT
TMGCTGPKSVIEVRSEKTFLDLSVQQIKEMNERYNIKVPLVLMNSFNTHQETGKIIQKYK
YSDVKIHSFNQSRFPRILKDNLMPVPDKLFGSDSEWYPPGHGDVFFALQNSGLLETLINE
GKEYLFISNVDNLGAVVDFNILEAMDKNKVEYIMEVTNKTRADVKGGTLIQYEGKAKLLE
IAQVPSSKVEEFKSIKKFKIFNTNNIWVNLKAMDRILKQNLLDDMDIIINPKVADGKNII
QLEIAAGAAIEFFNNARGVNVPRSRFLPVKSTSDLFIVQSNLYSLEKGVLVMNKNRPFTT
VPLVKLGDNFKKVSDYQARIKGIPDILELDQLTVSGDITFGPNMVLKGTVIIVANHGSRI
DIPEGSEFENKVVSGNLHCGAL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagccagatttaaatagtccattaccacaatcaccacaacttcaagcatttgga
agtagatcatcagatcttgcaaccgaggatttatttttgaagaaattggaagcaatctca
caaactgcaccaaatgaaacagtaaagaatgaatttttaaacaaagaaataccatctatc
aacaaattgtttacccgtttcttaaagaatagaaagaaagtaatcgattgggataaaatc
aatccaccaccagctgatatggttttaaactataaagatttaccagcaatcactgaacaa
agaacttcagaactcgcttcaaaattggctgttttgaaattaaatggaggtttaggtaca
acaatgggttgtactggtccaaagagtgttattgaagttagaagtgaaaaaactttctta
gatttaagtgttcaacaaattaaagaaatgaatgaaagatataatattaaagtaccatta
gtattaatgaattcatttaatactcatcaagaaactggtaaaatcattcaaaaatataaa
tattctgatgtaaagattcattcttttaatcaaagtcgtttcccaagaatcttaaaagat
aatttaatgccagtaccagataaattatttggtagtgattctgaatggtatccaccaggt
catggtgatgttttctttgcattacaaaattctggtctcttggaaacccttatcaatgaa
ggtaaagaatatttattcatttcaaatgtagataatcttggtgctgttgttgattttaac
attttagaagcaatggataaaaataaagttgaatatattatggaagttacaaataaaact
agagcagatgttaaaggtggtacattaattcaatatgaaggtaaagctaaattattggag
attgcacaagtaccatcatcaaaggttgaagaatttaaatcaataaagaaattcaaaatt
tttaataccaataacatttgggtcaatctcaaagcaatggatcgtattttgaaacaaaat
cttttggatgatatggatatcattatcaatccaaaggttgctgatggtaaaaatatcatt
caattggagattgctgctggtgctgcaattgaattctttaacaatgcaagaggtgtcaat
gtaccaagatcaagatttttaccagtgaaatcaacctctgatctctttatcgttcaatca
aatctctactcactcgagaagggtgttttggtaatgaacaagaatagaccattcaccaca
gttcccttggttaaattgggtgataactttaaaaaggtttcagattatcaagctcgtatc
aaaggtattccagatattttggaattggatcaactcaccgtttctggtgatataaccttt
ggtccaaatatggtcctcaaaggcactgttatcattgttgctaatcatggttcaagaatt
gatattcctgaaggttcagaatttgaaaataaagtagttagtggtaatttacattgtggt
gctttgtaa

DBGET integrated database retrieval system