KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278495Help
Entry
DDB_G0278495      CDS       T00245                                 

Gene name
alp
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ddi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 559 aa AA seqDB search
MEQAPNSSSIRESGIGGGGGGGGGGNDKDEMDGSTAIPMEPMTSSSGVSSGGGGKVVSHF
LLEEDFDSKKRFTSTHKRIFYILTSLAILVTVVLLIVFLLPRGWEGPKKKTNIIMMIGDG
MGPAALTMARVCFHTKGESTSQAHLHLDPYIVGTVKTYSSNSVVTDSAAAATAYASGVKT
YNNAVGVDANGKPAGTIIEAAKKLGMKTGLVVTTRISDATPACYFAHSATRHDEAFIIDQ
LLDKEIDVILGGGKQFFSNKTLQDAVSSKYNYSYVESKQEMEQVEAGRILGLFADYNIPW
EIDRLRDPTLLSTKPSLQEMTTKALNLISQNNENGFFLMVEGSKIDVAAHINDAPTQIWE
TDAFDQTFNLVREWAEKDGNTIVIVTADHETGGLTLANQMVIDGNPKYSWSPETLLTVNK
SADLMAELIKGGADPTKLIFDNTGYTLTSDDLKEINRTKSAYYLNQVIGRIVSNYADIGF
TTGGHTGEDVNLYTFGDTISEGKFETRLKDHQTEIVDNYIDPILRGNINNIDIASFIIKT
LNLDIQSITESLKDFIPKP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagcaccaaattcatcatcaatccgtgaatcgggtattggcggtggtggtggt
ggtggtggtggtggtaatgataaagatgaaatggatggatccactgcaattccaatggag
ccaatgacatcatcatcaggtgtaagtagtggtggtggtggtaaagttgtatcccacttt
ttattagaagaagattttgatagcaagaaaagattcacaagtacacataagagaattttt
tacatattgacatcattggcaatactagtgactgttgtgttattgattgtgtttttatta
ccaagaggatgggaaggcccaaagaaaaagacaaatataattatgatgattggtgatggt
atgggaccagcagcgttgaccatggcaagagtatgttttcatacaaaaggtgagagtaca
agtcaggcacatttacatttagacccatatatagtgggcacagtgaagacatactcaagc
aacagtgtggttaccgacagtgccgcagcggcaacggcctatgcaagtggtgtcaagacg
tataataatgcagtgggtgtcgatgcaaatggcaagccagcaggcacaatcattgaggca
gctaaaaagttgggtatgaagacaggattggtcgtcacaactcgtatctctgatgcgaca
ccagcatgctatttcgcacacagcgcaacgcgtcatgacgaggcattcattatcgatcaa
ttgttggacaaggagatcgatgtgatattgggtggtggtaaacaattctttagcaataaa
acacttcaagatgctgtatcaagcaaatacaactactcgtatgttgagagtaaacaagag
atggaacaagttgaagcaggtagaattttaggactctttgcagattacaacataccttgg
gaaatcgatcgtttaagagatccaacattactttcaaccaaaccatccctacaggagatg
accaccaaagcattgaatttaatctcacaaaacaatgaaaatggtttctttttaatggtg
gaaggctcaaagattgatgtggcagctcatatcaatgacgcacccactcagatttgggag
actgatgcatttgatcaaacttttaatctagttagagaatgggcagagaaggatggtaat
accattgtaattgtgacagcagatcatgaaactggtggtcttacattagcaaatcaaatg
gttatcgatggtaatccaaaatattcatggtcaccagagacattattgacagtgaataaa
tctgctgatctcatggcagaacttatcaaaggtggtgctgatccaacgaaattgattttc
gataatacaggttacacattaacatcagatgatttaaaagaaatcaatagaaccaagtct
gcctattatctcaatcaagtgattggtcgtatcgtttcaaactatgctgatattggtttc
accactggtggtcatactggtgaggatgtcaatctctacacctttggtgatacaatctct
gaaggtaaatttgaaactcgtctaaaagatcatcaaactgaaatagttgataattatatt
gatccaatcttaagaggtaatataaataatatagatattgcttcatttatcattaaaact
ttaaatttagatattcaatcaattacagaatcattaaaagattttattcctaaaccataa

DBGET integrated database retrieval system