KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279001Help
Entry
DDB_G0279001      CDS       T00245                                 

Gene name
gmkA
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DDB_G0279001 (gmkA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DDB_G0279001 (gmkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 202 aa AA seqDB search
MDNNSVDSLIPIIITGPSGVGKGTLIDKLRKEYEGSFGHIVSHTTRKPREGEINGVHYHF
TDIPTMTEGIKNGDFIEHANVHGNFYGTSKKALKDVSDKNKICILDIDVQGCESVKKANI
PCKFIFISPPTFETLQERLIGRGTENEETLKKRLETAKKEMVYRDIPGFFDHVIVNNVLD
VAYGELKSIISPFISFQSKSNK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggataataattcagtcgattctttaattccaattatcattactggtccatctggtgtt
ggtaaaggaacattaattgataaattaagaaaagaatatgaaggatcatttggacatatt
gtatcacatacaactcgtaaaccaagagagggtgaaattaatggtgttcattatcatttc
acagatatcccaacaatgacagaaggtattaaaaatggtgatttcattgaacatgcaaat
gtacatggtaatttttatggtacatcaaagaaagctcttaaagatgtttctgataaaaat
aaaatttgtattttagatatcgatgttcaaggttgtgaatctgttaaaaaagcaaacatt
ccttgtaaattcattttcatttcaccaccaacttttgaaactttacaagaaagattaatt
ggaagaggtactgaaaatgaagaaactcttaaaaagagattagaaacagcaaaaaaagaa
atggtttatagagatattcctggatttttcgatcatgttattgtaaacaatgttttagat
gtagcttatggtgaattaaaatcaattatttcaccatttatttctttccaatcaaaatca
aataaataa

DBGET integrated database retrieval system