KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279343Help
Entry
DDB_G0279343      CDS       T00245                                 

Gene name
aurK
Definition
Aurora family protein kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DDB_G0279343 (aurK)
Protein kinases [BR:ddi01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   DDB_G0279343 (aurK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 384 aa AA seqDB search
MSYPNNKENSNNIGGGSFSVPSKQPQRVLQQQNTNINNHQTTSTVKSTITKPTTTGATTS
TNTSTIPPTTTASSSSSSSSSSSSSSSSSSSSSSSSSQSVPKKKWCIDDFDIGKLLGMGR
FGHVYLAREKKSQFIVALKVLFKNQLQTHNIEHQLRREIEIQSHLRHPNILRLFGYFYDD
KRVFLIIEFAKGGECFKELQKVGSFNEQTAATYTLQIADALRYCHSKHVIHRDIKPENLL
IGVGGEIKIADFGWSVHAPNTKRSTFCGTLEYLPPEVIEKKGYDQTADVWSLGILIFEFL
VGRSPFTSDEEKNIFHNIQENDVYYPSSISPEAKDLISRLLVSDPHQRITLKDVINHPWI
KKHAHPKSLEPTKLGLPLPSQMTY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagttatccaaataataaagaaaatagtaacaatattggtggtggttcattctcagta
ccaagtaaacaaccacaaagagtacttcaacaacaaaatacaaatataaataatcatcaa
acaacatcgactgttaaatcaacaattacaaaaccaacaacaactggggccactacatca
actaatacttcaacaataccaccaacaacaacagcatcatcttcatcttcatcttcatct
tcatcttcatcttcatcttcatcctcatcttcatcttcatcttcatcatctcaatcagta
ccaaagaaaaaatggtgtattgatgattttgatattggtaaattattaggaatgggtaga
tttggtcacgtttatttagcaagggagaaaaagagtcaattcattgttgcactcaaagtt
ttatttaaaaatcaattacaaacacataatatagagcatcaattaagaagggaaattgaa
attcaatctcatttaagacatccaaatattttaagattatttggatatttttatgatgat
aaaagagttttcttaattattgaatttgccaaaggtggtgaatgttttaaagagttacaa
aaagtcggatcttttaatgaacaaactgctgctacttatacattacaaattgcagatgct
ttgagatattgtcattcaaaacatgttattcatagagatattaaaccagaaaatctttta
attggtgttggtggtgaaattaaaattgcagattttggatggtcagttcatgcaccaaat
acaaagagaagtacattttgtggtacattagaatatttaccaccagaagttattgaaaag
aaaggttatgatcaaacagctgatgtttggagtttaggtattctcatatttgagttttta
gttggtcgttcacctttcacctctgatgaagagaaaaatattttccacaatatacaagag
aatgatgtttattatccatcttcaatatcacctgaagcaaaagatttaatttcaagatta
cttgtatcagatccacatcaaagaattacattaaaagatgttattaaccatccatggatt
aaaaaacatgctcatccaaaatcactcgagccaacaaaattgggtcttccattaccatct
caaatgacttattaa

DBGET integrated database retrieval system