KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279699Help
Entry
DDB_G0279699      CDS       T00245                                 

Definition
HAM group protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DDB_G0279699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 657 aa AA seqDB search
MTNSDENTIKPDNSVDNNNSNSKNSTDIEFLESKSDDNNDQISETIKKIENNDANNDDKE
NIKVNDANNDEKEEKEKQKEKEKEKEKENIVNETITTETIQITDTKKIKEPIIITTTTAT
ATTTIESIAVIKNDIEEDTSEKPTKKLKETPINTDEESKTSQKISSITSAPTPTPTTPLT
KSSEPAPQPTTSTTASTTTAATTTNNNNNNNNNYNNNNNNNNNNNNNNRKVLENGTNIYC
FWRNKFQKCEIIDKREAESESGTFDYYVHYHSSNRRMDEWVHESRLDFNRLETDSGGGSG
GGSGSGGGGGNGSGTDGHLHHQKSSGQLAEIQTDGHSRKVTRQIKRKYEEMNHIQKGIDE
DHSKLSAIEKEHEEITKVKNINVIELGKFEIDTWYFSPYPEEFAKCDKLFLCEFCLKYMK
KKKTLNRHKLKCDLRHPPGNEIYRSGNISMFEVDGKKNKIYCQNLCLLAKLFLDHKTLYY
DVEPFLFYIMTECDQRGCHMVGYFSKEKDSPDGYNLACILTLPPYQRKGFGKLLISFSYE
LSKKESKVGTPEKPLSDLGLLSFRSYWTQVLLEILRKHKGNLSILDISNMTSIRTEDVIS
TLQSLNLIRYWKGQHIISVTPKAIEEHLKVYSKQTTRIDPKCIHWAPLNPPTTTKKR
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattcagatgaaaataccataaaacctgacaatagtgttgataataataatagt
aatagtaaaaacagcaccgatattgaatttttagaatcaaaatcagatgataataacgat
caaataagcgaaactataaaaaaaatagagaataatgatgcaaataatgatgataaagaa
aatataaaagtgaatgatgcaaataatgatgaaaaagaagaaaaagaaaaacaaaaagaa
aaagaaaaagaaaaagaaaaagaaaatattgtaaatgaaaccattaccacagaaactata
caaataacagatacaaagaaaattaaagaaccaataataataacaacaacaacagcaaca
gcaacaacaactattgaatcaatagcagttattaaaaatgatattgaagaggatacttca
gaaaaaccaacaaagaaattaaaagaaactccaatcaatacagatgaagaatcaaaaact
agtcaaaaaatttcatcaattacatcagcaccaacaccaacaccaacaaccccacttact
aaatcatcagaaccagcaccacaaccaacaacatcaactactgcctcaacaaccacagcc
gccaccaccactaataataataataataataataataattataataataataataataat
aataataataataataataataatagaaaagttttagagaatggaacaaatatatattgt
ttttggagaaataaatttcaaaaatgtgaaattattgataaaagagaagcagaatcggaa
tcaggtacatttgattattatgtacattatcattcttcaaatcgtcgtatggatgaatgg
gtacatgagtcaagattagattttaaccggttagagactgatagtggtggtggtagtggt
gggggtagtggtagtggtggtggtggtggtaatggtagtggtactgatggtcaccttcat
catcaaaagagtagtggacaattagcagagattcaaactgatggtcatagtagaaaagtt
acacgtcaaatcaaaagaaagtatgaggagatgaatcatattcaaaagggaatcgatgaa
gatcattcaaagttatcagccatcgagaaagaacatgaagagatcacaaaagtaaagaat
atcaatgtgattgaattgggtaaatttgaaattgacacttggtatttctccccctatcca
gaggaattcgccaagtgtgataaactattcctttgcgagttttgtttaaagtatatgaaa
aagaagaaaacattgaatagacataaattgaaatgtgatcttcgtcatcctccaggcaat
gaaatttacaggtcaggaaatatatcaatgtttgaagtcgatggtaaaaagaacaaaatc
tactgccagaacctctgtctattagctaaactctttttggatcataaaacattgtattat
gacgtcgagccatttctcttttacattatgaccgaatgcgatcagcgtgggtgtcatatg
gttggatatttctccaaagagaaggattctccagatggttacaatttagcttgtattctc
acattgccaccctaccaaagaaaaggttttggaaaactattgatctcctttagttatgaa
ctctctaaaaaggagagtaaagttggtacaccagagaaacctctttcagatttgggtttg
ctctctttcagatcgtattggactcaagtactcttggagattttaagaaaacataaaggt
aatctatcaattttagatatctcaaatatgacctcaattagaactgaagatgtaattagt
actctacaatctttaaatttaattagatattggaaaggtcaacatatcatttctgtcaca
ccaaaagcaattgaagaacatctcaaagtttattcaaaacaaacaactagaatagatcca
aaatgtattcattgggcacctttaaatccaccaacaacaactaaaaaacgttaa

DBGET integrated database retrieval system