KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280557Help
Entry
DDB_G0280557      CDS       T00245                                 

Definition
protein kinase, CMGC group
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 460 aa AA seqDB search
MEINKIIEINNNNNNNNNKIIENNNDNKKIIEINNNNNDNNKIIEINDNNNNNIKDKILK
KENKDSILMKPPPIFITPANKDDTITVFHQGHIISIPRKLKINLKSITDCGPDGVMFRAK
NEDSKEEVIVKKISVFLMKDDKMARKLLRNLLFQRHFQQHPLVSTFQSVFKRKSSENYLI
SNKNNRNNVRLPLLQQKGDDDIYFEYLLPEFTLLQMIHNKLLTEYNIMIFLYQLLTVVKF
MHSAGVIHRDIDPSAITIDQNQCLKLTEFYFCFPSNCPVDLFFNDYDTSSFIYRAPETIW
RNTTYTTAIDVWNIGVIFGEMILGKRLFKTQDFEDHLISISKLIGNPTAEDLSIVLSKSI
FQYMEKIPKSTLTPSVGIKRRFKGASKDQIELLQGMLCWDPRKRMTIDQLLAHKYFSTIH
DESMQIKCNEIFNLKYYPDFYKMKSDLVKKSIENEFLTPC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaataaaattattgaaattaataataataataataataataataataaaatt
attgaaaataataatgataataaaaaaattattgaaataaataataataataatgataat
aataaaattattgaaataaatgataataataataataatataaaagataaaattttaaaa
aaagaaaataaagactcaattttaatgaaaccaccaccaatattcattacaccagcaaat
aaagatgatactattactgtttttcatcaaggtcatattatatcaataccaagaaaattg
aaaattaatcttaaatcaattactgattgtggtcctgatggtgtaatgtttagagctaaa
aatgaagattctaaagaagaagttatcgtaaagaaaatatcggtattcttaatgaaggat
gataaaatggcaagaaaattattaagaaatttattattccaaagacattttcaacaacat
ccattggtatcaacattccaaagtgttttcaaaaggaaatcatctgaaaattatttaatt
tcaaataaaaacaatagaaataatgttagactacctttactacaacaaaagggtgatgat
gatatttattttgaatatcttttaccagagtttacattacttcaaatgattcataataaa
ctattaactgaatataatataatgattttcttatatcaattattaaccgtagttaaattc
atgcattccgctggtgtcatccatagagatatcgatccaagtgcaatcacaattgaccaa
aatcaatgtttgaaattaactgaattctatttttgctttccttcaaattgtccagttgat
ttatttttcaatgattatgatacaagttcatttatttatcgtgctcctgaaacaatttgg
agaaacacaacctatactactgccattgatgtttggaatattggtgtaattttcggtgaa
atgatattaggaaaaagactttttaaaacccaagattttgaagatcatttaatttcaatt
tcaaaattaattggtaatccaactgctgaagacctttcaatagttcttagtaaaagtatt
tttcaatatatggaaaaaattccaaaatcaactttaactccatcagttggaattaaaagg
agatttaaaggtgctagtaaagatcaaattgaattattacaaggtatgctatgttgggat
ccaagaaaaagaatgacaattgaccaattattagctcataaatatttttcaacaattcat
gatgaatcaatgcaaattaaatgtaatgaaatttttaatcttaaatattacccagatttt
tataagatgaaatcggatttagtaaaaaaatcaattgaaaatgaatttttaaccccatgc
tga

DBGET integrated database retrieval system