KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280893Help
Entry
DDB_G0280893      CDS       T00245                                 

Gene name
rbsk
Definition
ATP:D-ribose 5-phosphotransferase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DDB_G0280893 (rbsk)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DDB_G0280893 (rbsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 318 aa AA seqDB search
MENNITVVGASNWDTFIYVDKMPRVGETIKGTDLKVSYGGKAANQAVQASLLGSNCTLIT
KLGDDPSGVNTLKNFKDKNINCEFVSVVSNVPSGCATIIVDKNGDNNIIIIGGSNDLLNE
KDVDNAKSQIQNSSLLLCQLEVSLNVTLHALKIAKESNKCKTMLNLTPINNDPLILEMFK
FVDILIVNEIELIGLYNSTFNNNNNNEKDFNINQLMEMCDNLIKKFENFENIIVTLGGNG
QLLVSKENNKNCHIELKEKVKVVDTSGAGDSFIGSFAHYLVTENKPLKDSIESASKVASI
SVTRHGTQTSYPKSNEIN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatattacagttgttggtgcatctaattgggatacatttatttatgttgat
aaaatgccaagagttggtgaaacaattaaaggtacagatttaaaagtttcatatggtggt
aaggctgcaaatcaagctgttcaagcatcattattaggttcaaattgtacactcataact
aaattaggtgatgatccttctggtgttaatacattaaaaaattttaaagataaaaatata
aattgtgaatttgtatcagttgtatcaaatgttccatcaggatgtgctacaattatagtt
gataaaaatggtgataataatatcattattattggtggttcaaatgatttattaaatgaa
aaagatgttgataatgccaaatcacaaattcaaaattcttcactccttttatgtcaatta
gaagtttcattaaatgttacattacatgctttaaaaattgcaaaagaatcaaataaatgt
aaaacaatgttaaatttaacaccaataaacaatgatccattaattttggaaatgtttaaa
tttgttgatatattaattgtaaatgaaattgaattaattggattatataattcaactttt
aataataataataataatgaaaaagattttaatattaatcaattaatggaaatgtgtgat
aatttaattaaaaaatttgaaaattttgaaaatattattgtaacattaggtggaaatgga
caattattagtaagtaaggaaaacaataaaaactgtcatattgaattaaaagaaaaagtt
aaagttgttgatacttcaggtgctggtgatagttttattggtagttttgctcattatctt
gtaactgaaaataaaccattaaaagattcaattgaatctgcttcaaaagtagcttcaatt
agtgtaacaagacatggtactcaaacaagttatccaaaatcaaatgaaattaattaa

DBGET integrated database retrieval system