KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280979Help
Entry
DDB_G0280979      CDS       T00245                                 

Gene name
pcmA
Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     DDB_G0280979 (pcmA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 316 aa AA seqDB search
MVLILDNDLKPLYFTLAIISASFLVKRAYQSTNIYDFFNIKKKCNPFPQSQSELVDLLHY
QKRMVLNKTIVETLKFVDRKLFLENKNVENPYYDEPKPIGYNATISAPHMHALMLDLLAD
RIPMSNGVALDIGSGSGYVTACLGHLMGCTGRVIGVEHIPELIERSIESIKRLDSTLLDR
IQFLVGDGIKGWKQLKYDIIYLGAAIESLQVARELIDQLKNGGRIVMPVGKSNDFHELMV
VDKNEDGIVSIKSLGVVRFVPLTSKENQLNPKNKPNATKVTNINGEKTLIRCEIIPAPDS
NSNNNIKEFENLINKK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtactaatactcgacaacgatcttaaaccgttatattttactttagcaattatcagt
gcgtcttttttagtgaaaagagcctatcaatcaactaatatttatgactttttcaatatt
aaaaaaaaatgcaacccattccctcaatcacaaagtgaattagttgatttacttcattat
caaaaaagaatggtattaaataaaacaattgttgaaacattaaaatttgttgataggaaa
ttatttttagagaataaaaatgtagagaatccatattatgatgaacctaaaccaattgga
tataatgcaacgatatcagcacctcatatgcatgcattgatgttagatcttttagctgat
cgtataccaatgagtaatggagttgcattggatattggatcaggatcaggttatgttaca
gcatgtttaggacatttaatgggttgtacaggtagagttataggtgttgaacatattcca
gaattgattgaaagatcaatagagagtattaaaagattggattcaacattattagacaga
attcaattccttgttggtgacggtataaaaggttggaaacaattaaaatatgatatcatc
tatttgggtgctgccatcgaatcattacaagttgcacgtgaattaatagatcaattgaaa
aatggtggtagaatagttatgcctgttggtaaatcaaacgatttccatgaactcatggta
gtagataaaaatgaagatggtattgtatcaattaaatctttaggtgttgttagattcgta
cctctaacttcaaaagaaaatcaattaaatcctaaaaataaaccaaatgccacaaaagtt
acaaatataaatggtgaaaaaactttaattcgttgtgaaattataccagctcctgattca
aattcaaataataatataaaagaatttgaaaatttaataaataaaaaataa

DBGET integrated database retrieval system