KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281523Help
Entry
DDB_G0281523      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00052  Galactose metabolism
ddi00500  Starch and sucrose metabolism
ddi00520  Amino sugar and nucleotide sugar metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
Module
ddi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0281523
   00052 Galactose metabolism
    DDB_G0281523
   00500 Starch and sucrose metabolism
    DDB_G0281523
   00520 Amino sugar and nucleotide sugar metabolism
    DDB_G0281523
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DDB_G0281523
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DDB_G0281523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-GeneID: 8623057
NCBI-ProteinID: XP_640672
dictyBase: DDB_G0281523
UniProt: Q54TY9
Position
3
AA seq 367 aa AA seqDB search
MVYKVLGDYSKLIEEQKTDSQYFIGIDIGGTNTRVVYATENGDYYTIKEFLCSNITKLIE
ELTIIQNECLGNFIEPEFCCIDLAGPHLSKNKYKLTNYIESDNFLYTEKLPSKLCPPGKF
AVLNDLESGAYGIIPFMRSEGGLDSIFSTIVQQTGPLRQPDNCVYPVLAAGTGLGVGLIT
KFGDQYKVIPSEFGHISICSDTNDCEQELFKKLQNIIKEKEITRTNYSLEYEDIVSGRGV
QALYSIMKHENEPERNNSEIASQAAANPENLNCSCVKTMKIHYQYLVRCAREISVGTFGA
SVFLIGDNIVRNNAMVCSIKPFLGEEFLDHPKLEWLSTIPVFGQKIIINLNLIGCIFYAS
SQILKKN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaagtattaggagactactcaaaacttattgaagaacaaaaaacagactct
caatattttattggtattgatattggtggtacaaatacaagagtagtatatgcaacagaa
aatggtgattattatacaatcaaagaattcttatgcagtaatatcacaaaactcattgaa
gaattaacaattattcaaaatgaatgtttaggtaattttatcgaaccagaattctgttgt
atcgatcttgctggtccacatctttcaaaaaataaatataaattaaccaactatattgaa
tctgataatttcctttacacagagaaattaccaagcaaactttgtccaccaggtaaattt
gcagttttaaatgatcttgaaagtggtgcttatggtatcatcccattcatgaggtctgaa
ggtggtttagattcaattttctcaactatcgttcaacaaacaggtccattaagacaacca
gataattgtgtttacccagttttagcagcaggtactggtttaggtgtaggtttaatcact
aaatttggtgatcaatataaagttattccatcagagtttggtcatattagcatttgttca
gatactaatgattgtgaacaagaattattcaaaaaattacaaaacattattaaagaaaag
gaaattacaagaaccaactactcattagaatatgaagatattgttagtggtcgtggtgtt
caagcactttatagtattatgaaacatgaaaatgaaccagaaagaaataattcagaaatt
gcaagtcaagcagcagcaaatccagagaatttaaattgtagttgtgtaaagacaatgaaa
attcattatcaatatcttgttagatgcgctagagaaattagtgttggtacatttggtgca
tcagttttcttaattggtgataatatcgttagaaataatgcaatggtttgttcaattaaa
ccatttttaggagaagaattcttagatcatccaaaacttgaatggttatcaaccattcca
gtatttggtcaaaagattatcattaatttaaatttaattggttgtatcttttatgcaagt
tctcaaattttaaagaaaaactaa

DBGET integrated database retrieval system