KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281523Help
Entry
DDB_G0281523      CDS       T00245                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DDB_G0281523
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0281523
   00052 Galactose metabolism
    DDB_G0281523
   00500 Starch and sucrose metabolism
    DDB_G0281523
   00520 Amino sugar and nucleotide sugar metabolism
    DDB_G0281523
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    DDB_G0281523
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DDB_G0281523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 367 aa AA seqDB search
MVYKVLGDYSKLIEEQKTDSQYFIGIDIGGTNTRVVYATENGDYYTIKEFLCSNITKLIE
ELTIIQNECLGNFIEPEFCCIDLAGPHLSKNKYKLTNYIESDNFLYTEKLPSKLCPPGKF
AVLNDLESGAYGIIPFMRSEGGLDSIFSTIVQQTGPLRQPDNCVYPVLAAGTGLGVGLIT
KFGDQYKVIPSEFGHISICSDTNDCEQELFKKLQNIIKEKEITRTNYSLEYEDIVSGRGV
QALYSIMKHENEPERNNSEIASQAAANPENLNCSCVKTMKIHYQYLVRCAREISVGTFGA
SVFLIGDNIVRNNAMVCSIKPFLGEEFLDHPKLEWLSTIPVFGQKIIINLNLIGCIFYAS
SQILKKN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaagtattaggagactactcaaaacttattgaagaacaaaaaacagactct
caatattttattggtattgatattggtggtacaaatacaagagtagtatatgcaacagaa
aatggtgattattatacaatcaaagaattcttatgcagtaatatcacaaaactcattgaa
gaattaacaattattcaaaatgaatgtttaggtaattttatcgaaccagaattctgttgt
atcgatcttgctggtccacatctttcaaaaaataaatataaattaaccaactatattgaa
tctgataatttcctttacacagagaaattaccaagcaaactttgtccaccaggtaaattt
gcagttttaaatgatcttgaaagtggtgcttatggtatcatcccattcatgaggtctgaa
ggtggtttagattcaattttctcaactatcgttcaacaaacaggtccattaagacaacca
gataattgtgtttacccagttttagcagcaggtactggtttaggtgtaggtttaatcact
aaatttggtgatcaatataaagttattccatcagagtttggtcatattagcatttgttca
gatactaatgattgtgaacaagaattattcaaaaaattacaaaacattattaaagaaaag
gaaattacaagaaccaactactcattagaatatgaagatattgttagtggtcgtggtgtt
caagcactttatagtattatgaaacatgaaaatgaaccagaaagaaataattcagaaatt
gcaagtcaagcagcagcaaatccagagaatttaaattgtagttgtgtaaagacaatgaaa
attcattatcaatatcttgttagatgcgctagagaaattagtgttggtacatttggtgca
tcagttttcttaattggtgataatatcgttagaaataatgcaatggtttgttcaattaaa
ccatttttaggagaagaattcttagatcatccaaaacttgaatggttatcaaccattcca
gtatttggtcaaaagattatcattaatttaaatttaattggttgtatcttttatgcaagt
tctcaaattttaaagaaaaactaa

DBGET integrated database retrieval system