KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281569Help
Entry
DDB_G0281569      CDS       T00245                                 

Gene name
tor
Definition
FRAP subfamily protein kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Protein kinases [BR:ddi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   DDB_G0281569 (tor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 2380 aa AA seqDB search
MSQHEQPSIWADALTKLLNDLKSKKEEDRVKASKNLKSYVISQSREMTNENFTKFMNELN
NNLIFELVNSSVIPEKIGGIMAIDELIDVDYDENATKITRLANYLRIGLGFNDFTVMLMA
SKALGRLARSSGTLTAEFVEFEVTRALEWLSGDRIEARRHAAVLVLKELAQNAPTLFYVH
ASSFVDLIWVALKDPKVAIREGAVEALRACLELISERESRLRLQWYQKIYDEAQKSFKQN
GSPESIHGSLITVSELLRNTGDFMLSKFKDICETVLKYKDHRDKLVKKTVLALFPRLAVF
CSRDFVLNYFNACMNHLLAALRNQNERPTAFIALGEIAMAVGGSIKPYLDSIVVMIKQGL
MTKGKQFCPEVLTCISMLASAVGQSMYPHMQVILPQMIVSSGLTVVLTDALRDLTINLPT
LIPNIQYKLLNLISQVLANKPFSEPGAPSPYRKSATPFQGGSIPQLGQNSDVDPQMIALA
LKTLGSFDFSKHNLLEFVRECVVNYLDDDNIEIRREAAITCAQLMVGTEEPTPTRGHSAV
IVGEVLEKLLVVGIADPDPSIRKTVLSSLEARFDHYLAQAENLRSLFIALNDELFEIREL
AITVIGRLTIRNPAYVMPSLRKTLIQLLTELEFSGDGRNKEESARLLGHLISASEKLIKP
YVEPILKALLPKLRDSNPRVASCVLAALGELSVVGGEEMVQHIDSLLPLIIDTLQDQSST
SKREVALKTLAQLASSTGYVIKPFSKYPMLLDTLLNAIKTERIGSIRREVIKVLGILGSL
DPYKHKMNELGKRREDPKANDDKNNNMTNEVITISPSNEDYYPTVALTALMKILRDPSLS
SHHTSVIQAVMYIFKSLSLKSIPFLPQIMPPFLHAMNTGEPLFREFLFQQLGSLVSIVKQ
HIRDYLVNVFALIEKYWNSNLLIPIIKLVEEISSALNDEFKVYLPNLIPQMLNVLHTDRS
PKRSPTTKVLRALEVFGTNLDDYLHLVIPAIVKLFEQVDVTTQVRTLAIQTIGRLCKKLN
FSDYASRIIHPLARVLDSTESELREETLNTLCALVYQLGSDYAIFIPMVGKVLARREIQS
TNYELLISKLLKNQQLMLTPGSGDDGGMGANRFGGDHNGHHLGEDHNNTSTPLDIGVKKL
KANEQHLKNAWETSQRSTKEDWGEWIRRFSVELLRESPSPALRSCLSLAQDYHPLVKELF
NAGFVSCWTELHEQFQEELVRSLETALLSPNIPPEILQTLLNLAEFMELHEKPLPIDIRT
LGALAEKCHAYAKALHYKESEFSQSPSSTIEALISINNQLQQPEAAIGILIYAQKNHSVE
LKEGWYEKLRRWEDALAAYEKKQKDDPNGGTIENTMGILRCLHALGEWERLSALSSETWK
SDINDHTRATIAPLAAAAAWNLVNWDKMDEYVCAMNKDTVEGSFYRAILEVHHDNFTLAH
GFIDHARTLVDTELTALLGESYNRAYKVVVRLQQLSELEEIIEYKKCVDSPERRNMIKNT
WKTRLRGCQHNVDIWQSILAVHSLVISPHEELDMWLKFVGLCRKGSRLGLAQKTLTMLMG
KDPSTTSQFGSVLPNTHPRITFAYIKQLWSAGAKQPAFEKLRTFVQALRDTDDLPLQGRA
YLKLGEWQLALGDTLSEASIPHIISSFKAATECDPNWYKAWHSWALINFEVVSHYEQNGG
TPEQIGAHLLPAVHSFFKSISLGPDRSLQDTLRLLTLWFKHGAQKEVEAALMQGFNTISI
DTWLHVIPQIIARIHAPVLPVRRLLHELIDTIGKEHPQALVYPLTVATKSHSPARLAAAK
SLMDKMRKHSATLVDQALPVSQELVRTAILWLEMWYEGLEEASRQYFGDHNPEAMLATLA
PLHQILEKGPETTSETSFLQAFGRDLQEALEWSKKYEKTRKEGDLNQAWDLYYQVFRRIY
KQLPQMSSLELQYVSPKLLNSNNMELAVPGTYKASENVIRIQSFSQALSVIPSKQRPRKL
TIIGSDGLEYTFLLKGHEDLRQDERVMQLFSLVNNLLSANHETAKSHLSIRRFSVIPLSP
NSGLIGWVPHSDTLHTLIKDFRDSNKILLSIEHRLMLQMCSDYDNLTLLQKVEVFQYALE
NSNGLDLHKVLWLKSRNSEVWLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRHTGH
ILHIDFGDCFEVAMHRDKYPEKIPFRLTRMLINAMEVSGIEGNFRLTCEAVMNVLRNNKE
SLMAVLEAFVHDPLINWRLLTPNENNTKHKATNIASNNSTSNSTTKIEGDLNTIDNPINK
ESPDHEAVAGSLKSSPVHGRQIARNQRVGVDAEQVEAEIVPEALNERALSVINRVNKKLT
GRDFSSNETLDVPEQVQKLIDQATSHENLCLSYVGWCPFW
NT seq 7143 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacatgaacaaccttcaatatgggccgacgctttaactaaactcttaaatgat
ttaaagagtaaaaaagaagaagatagagtcaaagcatcaaaaaatttaaaatcatatgtt
atatcacaaagtagagaaatgacaaatgaaaattttacaaaatttatgaatgaattaaat
aataatttaatatttgaattggtgaatagttcagttataccagaaaagattggaggtatt
atggcaattgatgaattaatagatgtagattatgatgagaatgcaacaaagatcacaaga
ttagccaattatttacgtattggtttaggattcaatgattttacagtaatgttaatggca
tcaaaagcattgggtagattagcacgttcaagtggtacattgacagcggaatttgtagag
tttgaagttacaagagcattggaatggttaagtggtgatcgtatcgaagcaagaagacac
gctgcagtattggtattgaaagagttggctcaaaatgcaccaacactcttttatgtccat
gcatcatcatttgtcgatttaatttgggtggcattaaaagatccaaaagttgcaattcgt
gaaggtgccgttgaggcgctaagagcatgtctagagttgatctctgagagagaatcacgt
cttcgtttacaatggtatcaaaagatttatgatgaagctcaaaaatcattcaaacaaaat
ggttcaccagaatcaatacatggttcattaatcaccgttagtgaattacttagaaataca
ggtgattttatgctttcaaaatttaaagatatttgtgaaaccgttttaaaatataaagat
catcgtgataaattagttaaaaaaactgtattggcattattcccaagattagcagtattt
tgttcaagagattttgtattaaattattttaatgcgtgtatgaatcatttattggcagca
ttaagaaatcaaaatgaaagaccaacagcatttatagcattgggtgagatagcaatggcg
gttggtggatcgattaaaccttatttagattcaattgttgtaatgataaaacaaggatta
atgacaaagggtaaacaattttgtccagaggtattgacatgtatatcaatgttagcatca
gcggttggccaatcaatgtatccacatatgcaagttatattaccacaaatgatagtttca
agtggattgacggtggttttaactgatgctttaagagatttaacaattaatttaccaacg
ttaataccaaacattcagtataaactattgaatttaattagtcaagtcttggcaaataaa
ccattctctgaacctggtgcaccatcgccctacagaaagagtgcaacacctttccaaggt
ggttcaataccacaattgggtcagaattcagatgttgatccacaaatgattgcattggct
ttgaaaactttgggtagctttgatttctctaaacataatctattggaattcgttagggag
tgtgttgtaaactatttggatgatgacaacattgaaattcgtagagaggctgccattact
tgtgctcaacttatggtaggaactgaagaaccaacaccaactcgtggtcattctgctgtt
atcgtaggtgaggtattggagaaactattggttgttggtattgctgatcctgatccatca
attcgtaagactgtattatcaagtttagaggcacgtttcgatcattatttagcacaggca
gagaatttacgttcattattcatcgcattgaacgatgagttatttgaaattcgtgaattg
gcaatcactgtaattggtcgtttaacaattagaaatccagcatatgttatgccatcactt
cgtaaaacattaattcaactactaacagaattggaatttagtggtgatggtagaaataag
gaagagagtgcaagattattaggtcatttaatttcagcgtcagagaaattaattaaacca
tacgtagaaccaattcttaaggcattgttaccaaaattacgtgatagtaatccacgtgtt
gcatcttgtgtattggctgcattgggtgagttatcagtggttggtggtgaagagatggta
caacatatagattcattgttacctctaatcattgatacacttcaagatcaaagttcaact
tcaaagagagaagttgcattgaaaacattggcacaattagcttcatcaactggttatgtt
attaaaccattctcaaagtatccaatgctattggataccctattgaatgcaattaaaacc
gaaagaattggttcaattagaagagaggttatcaaggttttaggtattttaggttcattg
gatccatataaacataaaatgaatgaattgggtaaacgtagagaagatccaaaagcaaac
gatgataagaataacaatatgaccaatgaagtgattacaatttcaccatcgaatgaagat
tattatccaaccgttgctttgacggccttaatgaaaatccttagagatccatcattatcc
tcgcatcatacaagtgtaattcaagctgttatgtatatctttaagagtttatcattgaaa
tcaattccattcttaccacaaattatgccaccattccttcatgctatgaacactggtgaa
ccattatttagagaattccttttccaacaattgggttcattggtatcaattgtcaaacaa
catattcgtgactatttagttaatgttttcgctttaattgaaaaatattggaactcgaat
ctattaattccaatcattaaattggtcgaagagatttcatcagctttaaatgatgaattt
aaagtttatttaccaaatttaattccacaaatgttaaatgtacttcatactgaccgttct
ccaaaaagatcaccaaccactaaagttttaagagcattggaagtatttggtaccaattta
gatgattacctacatttggtaattcctgcaatcgttaaattattcgaacaagtagatgta
accactcaagttagaactttggcaattcaaaccattggtagactttgtaagaaattgaat
ttctctgattatgcatctcgtatcattcatccattggcaagagttttagatagtaccgag
agtgaattacgtgaagaaactttaaatactctctgtgctttagtttatcaattgggttca
gattatgcaattttcattccaatggttggtaaggttttagcacgtcgtgaaattcaatca
acaaattatgaattactcattagcaaattgttaaagaatcaacaattaatgttaacccct
ggttcgggtgatgatggtggtatgggtgcaaatcgtttcggtggtgatcataatggtcat
catttgggtgaagatcataataacacaagtactccattggatattggtgtaaagaaatta
aaggcaaatgaacaacacctaaagaatgcttgggaaacttcacaacgttcaaccaaagaa
gattggggtgaatggattcgtagattctctgtggaattacttcgtgaatcaccatcacct
gcacttagatcctgtttatcattggcacaagattatcatccattagttaaagagttattc
aatgctggtttcgttagttgttggactgaattacacgaacaattccaagaagaattggtt
agaagtttagagaccgctttactctctccaaatattccacctgaaatccttcaaaccctt
ttgaatcttgcagagtttatggaacttcacgagaaaccattaccaatcgatattcgtaca
ttgggtgcattggcagagaaatgtcatgcctatgcaaaagctttacattataaagagtct
gaattctctcaatcaccatcttcaaccattgaggctttgattagtattaacaatcaactt
caacaaccagaagctgccattggtattttaatttacgctcaaaagaatcatagtgtcgaa
ttgaaagaaggttggtatgaaaaattaagaagatgggaagatgcacttgctgcctatgaa
aagaaacaaaaagacgatccaaatggtggtaccattgaaaatactatgggtattttaaga
tgtttacatgcattgggtgaatgggaaagattatctgcactctcatcagaaacttggaaa
tcagatatcaatgatcatactcgtgcaaccattgcaccattggctgcagctgccgcttgg
aatcttgtaaattgggataaaatggatgaatatgtgtgtgcaatgaataaagataccgtt
gaaggttcattctatcgtgcaatactcgaagttcatcatgacaatttcacattggcacat
ggctttattgatcatgctcgtactttggtagatactgaactaactgcattattaggtgag
agttataatcgtgcctataaagtagtggttcgtcttcaacaattatcagagctcgaagaa
atcattgaatataaaaaatgtgtagattcaccagaacgtagaaatatgattaagaatact
tggaaaactcgtttaagaggttgtcaacataatgtcgatatttggcaatcaattcttgcc
gttcatagtttagtgatttcacctcatgaagagttggatatgtggttgaaatttgttgga
ctttgtagaaaaggttcaagattaggtttagctcaaaaaactctaaccatgttaatgggt
aaagatccatcaacaacaagtcaattcggtagtgtacttccaaatactcatccaagaatt
acctttgcctatattaaacaactttggagtgcaggtgctaaacaaccagcatttgaaaag
ttacgtacatttgttcaagcgctaagagataccgatgatttaccattacaaggtcgtgcc
tatttgaaacttggtgaatggcaattggcattgggtgatacattgagtgaagcttccatt
ccacatattattagttcatttaaagccgcaactgaatgtgatccaaattggtataaagca
tggcatagttgggcattaattaatttcgaagttgtatcacattacgaacaaaatggtggt
acaccagaacaaattggtgcacatttattgccagcagttcatagtttctttaaaagtatt
tcattgggtcctgatcgttcattacaagatacacttcgtctactaacactttggtttaaa
catggtgctcaaaaagaggttgaagccgctttaatgcaaggttttaataccatttcaatc
gatacttggttacatgttattccacaaattattgcacgtattcatgctccagtcctacca
gttcgtcgtttacttcatgagctaattgataccattggtaaagaacatccacaagcattg
gtatatccattaactgtagcaactaaatctcattcaccagcacgtttagccgcagcaaaa
tcattgatggataaaatgagaaaacattccgctacattggtagatcaagcattaccagta
agtcaagagttggtacgtactgcaattctttggttagagatgtggtatgaaggtttggag
gaagcttctcgtcaatactttggtgatcataatccagaggcaatgttggcaacattggca
ccacttcatcaaatacttgagaaaggtccagagacaacaagtgaaacctctttccttcaa
gcatttggtagagatcttcaagaggctctcgaatggagtaagaaatatgaaaaaacacgt
aaagaaggtgatcttaatcaagcatgggatctctattatcaagtgtttagacgtatctat
aaacaattaccacaaatgtcatcattggagcttcaatatgtttcaccaaaacttttaaat
tcaaacaatatggaactcgctgtaccaggtacctataaagccagtgaaaacgtcattaga
attcaatcattctctcaagccctctcagttattccttcaaaacaacgtccaagaaaatta
acaatcattggtagtgatggtcttgaatatactttccttttgaaaggtcatgaagatctt
agacaagatgaacgtgttatgcaattgtttagtttggttaataatcttttgtcagccaat
catgaaaccgctaaatctcatctaagtattcgtagattctcagttattccattatcacca
aactctggtctaattggttgggttccacattccgatacacttcatactttaattaaagat
ttccgtgatagtaataagatcctattgtcaattgaacatcgtttaatgttacaaatgtgc
tcagattatgataatcttacattacttcaaaaggttgaagtattccagtatgctttggaa
aattcaaatggtttagatcttcataaggttttatggttgaaatcaagaaatagtgaagtt
tggttagatcgtcgtacaaactatacacgttctttggcagtaatgagtatggttggttat
attttaggtttaggtgatcgtcatccttccaatttaatgttggatcgtcataccggtcat
attttacacattgattttggtgattgcttcgaagtcgcaatgcatcgtgataaataccca
gagaaaattccattccgtttaactcgtatgcttattaatgctatggaagtctctggtatc
gaaggtaatttcagattaacttgtgaagccgttatgaatgtacttagaaataacaaggaa
agtcttatggccgtcttagaggcctttgttcatgatccacttattaactggcgtctttta
actccaaatgaaaataataccaaacataaagctacaaacattgcaagtaataatagtacc
tcaaattctaccacaaagattgaaggtgatctcaatacaatcgataatccaatcaataaa
gaatcaccagaccatgaagctgttgctggctccctcaaatcctcaccagttcatggtaga
caaatcgctcgtaaccaaagagttggtgttgatgctgaacaagttgaagctgaaatcgta
cctgaagcattaaatgaaagagcactttcagttattaatcgtgtaaataagaaattaact
ggtagagattttagttcaaatgaaactttagatgtacctgaacaagttcaaaaattaatt
gatcaagcaacttctcatgaaaatctttgtcttagttatgttggttggtgtccattttgg
taa

DBGET integrated database retrieval system