KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281979Help
Entry
DDB_G0281979      CDS       T00245                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DDB_G0281979
Translation factors [BR:ddi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    DDB_G0281979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 284 aa AA seqDB search
MVHQLSSTYYFYYMPKRPKTMNDYLAGLQCISGPIKTVEDFWSYYSHMIRPVDEFSQLSD
IYFFREGIKPIWEDTENKDGGKFVVKTRRNYTSKWWEDLLLAFIGEQVDGVENINGIVIS
FRSNDNNLIGIWNKNSEDTDRLLISLKQLFKIEKLDYKPHFNRLQKEEQFGNGKDSNNSS
LQSSLNESGNGIGIHHSDSLGDSFDFIKQHSSPNSINSPLNSLNVNNNNNNNNSNNTISN
QQQQQLNNLQSPQQIQQYLHQLQHQQYLQQFQQFGFSQNPLGKS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatcaattatcaagtacttattatttttattatatgccaaaaagacccaagact
atgaatgattatttagctggccttcaatgtatatccggtccaattaaaactgttgaagat
ttttggagttattacagccacatgattagaccagttgatgaattttctcaattaagtgat
atttatttttttagagaagggatcaaaccaatttgggaggatacagaaaacaaagatgga
ggtaaatttgttgtaaaaaccagaagaaattatacttcaaaatggtgggaagatttatta
ttagcattcattggagaacaagtagatggtgttgaaaatataaatggtatcgttatctca
tttagatctaatgataataatttaattggtatttggaataagaatagtgaagatactgat
agattattaataagtttaaaacagttattcaaaattgaaaaattagattataaacctcac
tttaatagattacaaaaagaagaacaattcggaaatggaaaagatagtaataatagtagt
ttacaatcatcattaaatgaaagtggcaatggtattggaattcatcatagtgattcactt
ggtgatagttttgatttcattaaacaacactcgtctccaaattcaataaattctccatta
aatagcttaaatgtcaacaacaacaacaataacaacaacagtaacaacacaatttcaaac
caacaacaacaacaattaaacaacttacaatcaccacaacaaattcaacaatatcttcat
caattacaacatcaacaatatctccaacaatttcaacaatttgggttctctcaaaatcct
ttaggaaaaagctaa

DBGET integrated database retrieval system