KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282005Help
Entry
DDB_G0282005      CDS       T00245                                 

Definition
phospholipase/carboxylesterase family protein
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DDB_G0282005
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DDB_G0282005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 226 aa AA seqDB search
MIKTILKNSYIQKEITTHSATVIFSHGLGDSGAGWIEVMEEIQSRNNGHIRFICPNAPIQ
AVTLNGGFKMPSWYDIKSLSSRGDEDPAQVDESKNIIETIIKHEMEEEKIPAERIIIGGF
SQGAALSLYTFYSQTETKLGGCIALSGYLPLATKFVANSLNKEQPLLMIHGDCDQVVRHQ
WGKLSFDHLKSQGINGEFITLKGLGHHSSPEEIDLMTKFISKTLPK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaactattttaaaaaactcttacatccaaaaagaaattactacacactcagca
acagttattttcagtcatggcttaggtgatagtggtgctggttggattgaagtaatggaa
gagattcaaagtagaaacaatggtcacattagattcatttgtccaaatgcaccaattcaa
gcagttacacttaatggtggatttaaaatgccatcatggtatgatattaaatcattatca
tcaagaggtgatgaagatccagctcaagttgatgaatcaaagaatataattgaaactatt
atcaaacatgaaatggaagaagagaaaattccagctgaaagaattataattggtggtttt
tcacaaggtgcagcattatcattatatacattttattcacaaactgaaaccaaattaggt
ggttgtattgcattatcaggttatttaccattggcaactaaatttgtagcaaattcatta
aataaagaacaaccattactcatgatccacggtgattgtgatcaagtagttcgtcatcaa
tggggtaaattatcattcgaccatttaaaaagtcaaggtattaatggtgaatttataaca
ttaaaaggtttaggtcatcattcaagtccagaggaaattgatttaatgacaaagtttatt
tctaaaacattaccaaaataa

DBGET integrated database retrieval system