KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282539Help
Entry
DDB_G0282539      CDS       T00245                                 

Gene name
nagB
Definition
glycoside hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DDB_G0282539 (nagB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    DDB_G0282539 (nagB)
   00603 Glycosphingolipid biosynthesis - globo series
    DDB_G0282539 (nagB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    DDB_G0282539 (nagB)
   00511 Other glycan degradation
    DDB_G0282539 (nagB)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DDB_G0282539 (nagB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
3
AA seq 541 aa AA seqDB search
MINKFLTIFLIFSIVIIKVLSQSSNEQPLNVVPYPQEVTMIGCNIPLSVGSISIKSNIES
TILSISISRYQSLFFPFVSNNVLKDSSSNIELSLIIASDDETLELGIDESYFLLVNQDTY
QIKANTIYGAMRGLETFKQMVVYDVVENSYSLTCAEVVDYPTYQWRGLLVDNARHFLPKN
MVLHIIDSMGYNKFNTMHWHLIDTVAFPVESKTYPKLTEALLGPGAIITHDDILEVVAYA
KTYGIRVIPEFDVPGHSASWGVGYPELLSNCPGYPQSSIPLDCSNPYTYSFLENFFSEIA
PLFQDSYFHTGGDELVIDCWANDTSIQKWMKTNNYNTSDAFQYFEDQLDVILKSINRTKI
AWNDVLQHGVKFDKETTLVQTWTNINDLRDVLAAGYKTITSFFFYLDRQSPTGNHYHYEW
QDTWEDFYASDPRLNITSNAENILGGEATMFGEQVSTVNWDARVWPRAIGISERLWSATE
INNITLALPRIGQFSCDMSRRGISSGPLFPDFCSLPDDLSFSFKPVYQLSKDEIKLILKK
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaatttttaacaatttttttaatattttcaattgtaataattaaagtttta
tcacaatcatcaaatgaacaaccattaaatgtagtaccatatccacaagaagttacaatg
attggttgtaatattccattatcagtaggatcaatatcaattaaaagtaatattgaatca
acaatattaagtatttcaatttcaagatatcagagtttatttttcccatttgtttcaaat
aatgttttaaaagatagctcttcaaatatcgagttatcattaattattgcaagtgatgat
gaaacacttgaattgggtattgatgaaagttactttttattagtgaatcaagacacttat
caaataaaagccaatacaatctatggtgcaatgagaggtttagaaacattcaaacaaatg
gtagtttatgatgttgtagaaaatagttactcattgacatgtgctgaagttgtagactat
ccaacctatcaatggagaggattgttggttgataatgcccgtcatttccttccaaagaat
atggtacttcatattattgactcgatgggttataataaattcaatactatgcattggcat
ttaatagatactgttgcattcccagtggaatcgaaaacctatccaaagttaactgaagca
ttacttggacctggtgcaattattacacatgatgatattttagaggtggttgcctatgct
aaaacctatggaattcgtgtgattcctgaatttgatgttccaggccattctgcatcatgg
ggtgtaggctatccagagctgttatccaattgtccaggctatccacaaagttcaattcca
ttagattgttcaaatccatacacttatagttttcttgaaaactttttctcagagattgca
cctctattccaagatagttatttccatactggtggtgatgaattggtaattgattgttgg
gccaatgatacttcaattcaaaaatggatgaaaactaataactataatacttctgatgct
tttcaatattttgaagatcaattagatgtaattttgaaatcaattaatcgtactaaaatc
gcctggaatgatgtacttcaacatggtgttaaatttgataaagaaactactttggttcaa
acttggacaaatattaatgatctaagagatgtactagccgctggttataaaactataaca
tcgttctttttctatttagatagacaatcaccaactggaaatcattatcattatgaatgg
caagatacttgggaagatttctatgcatcagatccaagattaaatattacttcaaatgct
gaaaatattttaggtggtgaagctactatgtttggtgaacaagttagtaccgtcaattgg
gatgccagagtttggccaagagctattggtatctctgaaagattatggtctgctactgaa
attaataatatcactcttgctctccctcgtattggccaattctcttgtgatatgtctcgt
cgtggtatttcctctggtccattattccctgatttttgctcattacctgatgatttatct
ttttcttttaaaccagtttatcaattatcaaaagatgaaattaaattaattttaaaaaaa
aaataa

DBGET integrated database retrieval system