KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283459Help
Entry
DDB_G0283459      CDS       T00245                                 

Gene name
gcn5
Definition
GCN5-related N-acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DDB_G0283459 (gcn5)
Transcription machinery [BR:ddi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     DDB_G0283459 (gcn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 412 aa AA seqDB search
METQQPTLLQDNNNNNNNNNYNLNIGNNDIVNQHPPQIQQQQQQQQQQQQPPQQLLGPED
GLQIDNSRGITAKEEKERGILRFEVITNDSSSKNLELLMNLKNVFSKQLPKMPREYIVRL
MFDRFHHSLLIIKNNNVIGGICFRPFQQQGFIEIAFCAITSSEQVKGYGSFLMTHLKEHN
RKVGIYHFLTFADNFAIEYFQKQGFTHDITLLKEKWKGFIQEYDGGSLMECVVHPNVTYL
DIPTMVKAQRNALNEKIRTISTSHLVYSGLQCFNHGQRRIPIEKIPGILEAGWINNVGNV
DQQQQQINSLQQQLAVVLQSIKNHDDSWPFLQPVSIEEVPTYYTTVKDPVDLQMISDRLA
TGNYYITKNIFLADLKRMCNNCREFNGENSPYYDNADRLEKYCKNLVNNLKI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacaacaaccaacattattacaagataataacaataataataataataataat
tataatttaaatataggtaataatgatatagtgaatcaacatccaccacaaatacaacaa
caacaacaacaacaacaacaacaacaacaaccaccacaacaattattaggaccagaagat
ggtttacaaattgataattcaagaggtataacagcaaaagaagagaaagaaagaggtata
ttaagatttgaagttataacaaatgatagtagttcaaagaatttagaattattaatgaat
ttaaagaatgtattctctaaacaattaccaaagatgccaagagaatatattgttagatta
atgtttgatagatttcatcattcattattgattattaaaaataacaatgtaattggtggt
atttgttttagaccatttcaacaacaaggtttcatagagattgcattttgtgcaatcaca
agcagtgaacaagtgaaaggctatggttcattcctaatgactcatttaaaagaacataat
agaaaagttggaatttaccatttcctaacgtttgcagataactttgcaattgaatatttt
caaaaacaaggattcactcatgatataacattgctaaaagagaaatggaaaggtttcatc
caagagtatgatggtggttcattaatggagtgtgttgtacacccaaatgtaacctattta
gatataccgactatggtaaaagcgcagagaaatgcattgaatgaaaagattcgtactatt
agtacctcacatttagtttattcaggtttacaatgttttaatcatggtcaaagacgcata
cccattgaaaagatacctggtatattagaagctggttggattaataatgttggaaatgtt
gatcaacaacaacaacaaataaattcacttcaacaacaattggcagttgtattacaaagt
attaaaaatcatgatgattcatggccttttcttcaaccagtttcaattgaagaagtacca
acctattatacaactgtcaaagatcctgtcgaccttcaaatgatctctgatcgtttagca
actggaaattattatatcactaaaaatatctttttagctgatcttaaaagaatgtgtaat
aattgtagagaatttaatggtgaaaattcaccttattatgataacgcagatcgtttagaa
aaatattgtaaaaatttagtaaataatttaaaaatttaa

DBGET integrated database retrieval system