KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283597Help
Entry
DDB_G0283597      CDS       T00245                                 

Gene name
eIF3s9
Definition
RNA recognition motif-containing protein RRM
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DDB_G0283597 (eIF3s9)
Translation factors [BR:ddi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    DDB_G0283597 (eIF3s9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 670 aa AA seqDB search
MTIFDSDEEELVTTLSDFEPPVQIDTSFNKFIVVDNIPVAPEAKHEKLKSILVKIYQNRP
GAEVVGIHLALDAQRNTKGFAFIEYSKKESAIDAATSLNNYPLDKSHTLKVNLLDDFSKF
ANFEETYKPPTREDFKPKPNYNQWLSDPKALKGYDQFVTRYGDYTDICWNEMHVGKPMVE
KSSVSLTSSYVQWSNTGSYLVTFHPDGIALYGGKDWIQVNLFEHRGVQLVDFSPEDKYLI
TFAPIASDNPNSPKSIVVWDVRSGKKLRSFLAPPKEQFTWPAFQWSAKDKYIARIEQLEK
GINIYETPSMNLLDDKIFEVKGIKDFSWSPTDLSLAYFVPANDPLPAKICLVEMPSKKLL
AEKSIWGATDARFHWQNEGAYLCVKTDKVATGKTKKEKIPTTSFELFRTHEPNVPIESFE
IQYAIKAFSWEPRGKRICIIHGEFKMNMFVSFFEVQKTSVKLISKLENRKLNTIFWSPRG
TLVLLANLGDTGELEFYNTQDCESYGTQEHLQCTGVDWNPSGRYVTTFVSHWKVQTDTGF
NIWSFNGDLVYSVLKDRFFQFNWRPRPKFMLTNKEINQIKQNIKKYQEKFDKQDEDDNKA
IQHIEQTRLDNLMKEFLSFLQKGEQEYQALEPTRKQLGSYEDIDPNDIYESIETIEELID
IKTIVLKKIN
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctttgatagcgacgaagaagagttagttactactctcagtgatttcgaacca
ccagttcaaattgatacttcattcaataaatttattgtagttgataatattccagttgca
ccagaggcaaaacacgagaaattgaaatctattttagttaaaatctatcaaaatagacca
ggtgctgaagttgttggtattcatttagcattagatgctcaaagaaatactaaaggtttt
gcatttattgaatattcaaaaaaagaatcagcaattgatgcagcaacttcattaaataat
tatccattagataaatcacatacattaaaagttaatttattagatgattttagcaaattt
gccaattttgaagaaacttataaaccaccaactagagaagattttaaaccaaaaccaaat
tacaatcaatggttatcagatccaaaagcattgaaaggttatgaccaatttgtaacacgt
tatggtgattatacagatatttgttggaatgagatgcatgttggtaaaccaatggtagag
aaatcatcggtttcattgacctcatcatacgttcaatggtcaaacactggtagttattta
gttacattccacccagacggcattgctttgtatggtggtaaagattggattcaagtgaat
cttttcgaacatcgtggtgttcaattggtagatttctcaccagaggataaatatttgatt
acatttgcaccaattgcatccgataatccaaactcaccaaaatccatcgtagtatgggat
gtacgtagtggcaagaagttgagatcattcttggccccaccaaaggagcaattcacatgg
ccagccttccaatggtccgccaaggataaatacattgcacgtatcgaacagttggagaag
ggtatcaacatctatgaaactccatcaatgaatcttttagatgataaaattttcgaagtc
aaaggtatcaaagatttcagttggtcaccaaccgatttatcattggcctactttgtacca
gcaaatgatccattaccagcaaagatctgtctcgttgagatgccatccaagaaactcctc
gccgaaaagagtatttggggtgccaccgacgcccgtttccattggcaaaatgaaggtgct
tatctttgtgtaaagaccgataaagttgccactggtaagaccaaaaaagaaaagattcca
accactagctttgaactcttccgtactcatgaaccaaacgtaccaattgaatcctttgaa
attcaatacgcaatcaaagccttctcttgggaaccaagaggcaagagaatttgtatcatt
catggtgaattcaagatgaacatgtttgttagtttctttgaagttcaaaaaacaagtgtt
aaactcattagtaaattagagaatcgtaaattgaataccatcttttggtcaccacgtggt
actttggtattattggccaatttgggtgacactggtgaattggaattctacaacactcaa
gactgtgaatcctatggcactcaagaacatctccaatgtactggtgtcgattggaatcca
tctggtcgttatgttaccacctttgttagtcattggaaggttcaaaccgatactggtttc
aacatttggtcattcaatggtgatctcgtctactctgtactcaaggatcgtttcttccaa
ttcaattggcgtccaagaccaaaattcatgctcaccaataaagaaatcaatcaaatcaaa
caaaacatcaaaaaatatcaagagaaattcgataaacaagatgaagatgataataaagcc
attcaacatattgaacaaactcgtcttgataatttaatgaaagaatttttatctttcctt
caaaaaggtgaacaagaatatcaagcactcgaaccaactagaaaacaacttggttcttat
gaagatattgatccaaatgatatctatgaatcaattgaaacaattgaagaacttattgat
attaaaactattgttttaaagaaaataaattaa

DBGET integrated database retrieval system