KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283835Help
Entry
DDB_G0283835      CDS       T00245                                 

Gene name
rae1
Definition
WD40 repeat-containing protein
Orthology
K14298  
mRNA export factor
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ddi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 342 aa AA seqDB search
MFSTSTTTNPNNDIELSSPPSDGVSCLKFSPKANNFIVAGSWDQKVRCWEINPSTKSSMP
KAIISHDAAILCTDWSGDGTKVFTGGVDGKGKCWNLATNQMVQVAQHTAPIKECFWIEES
NVLVTASWDKTLKYWDTRQQTGTPVLSLELTERIYAMDMLYPLLAVATADKKIYIYDLKN
PQSPYKTVDSLLKFQTRCISCFPDKSGFALGSIEGRVAIQSLDDSKQENSFTFKCHREND
TVAYAVNNISFALPYGTFATAGSDGGFSFWDKESKFRLKQFSKLPQSISTATFNLDASLY
AYASSYDWSKGSQYFDPNQPNSIFVRVVGDEAKKGNRQTKKR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaacatcaacaactacaaacccaaataatgatattgaattatcaagtccacca
agtgatggtgtatcttgtttaaaattctcaccaaaagcaaacaattttatagtagcaggt
tcatgggatcaaaaagttagatgttgggaaataaatccatcaacaaaatcatcaatgcca
aaagcaatcataagtcatgatgctgcaattttatgtacagattggagtggtgatggtaca
aaagtatttacaggtggtgttgatggtaaaggaaaatgttggaatttagcaactaatcaa
atggtacaagtagcacaacatacagcaccaattaaagaatgtttttggattgaagagagt
aatgtattagttacagcatcatgggataaaacattgaaatattgggatacaagacaacaa
acgggtacacctgttttatcattagaattaactgaaagaatatatgcaatggatatgtta
tacccattattagcagttgcaacagcagataaaaaaatttatatttatgatcttaaaaat
ccacaatcaccttataaaactgtagactcattattaaaatttcaaacaagatgtatatct
tgtttccccgataaaagtggtttcgctttaggttcaattgaaggtagagttgcaattcaa
tctttagatgattcaaaacaagaaaattcatttacatttaaatgtcatagagaaaatgat
acagtagcatatgcagttaataatatttcatttgcattaccatatggtacattcgcaaca
gcaggttctgatggtggtttcagtttttgggataaagaatccaaatttagattaaaacaa
ttttcaaaattaccacaatcaatttcaacagcaactttcaatcttgatgcttctttatat
gcttatgcatcatcttatgattggagtaaaggtagtcaatattttgatccaaatcaacca
aattcaattttcgttcgtgtggttggtgatgaagcaaaaaaaggaaatagacaaactaaa
aagagataa

DBGET integrated database retrieval system