KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283907Help
Entry
DDB_G0283907      CDS       T00245                                 

Gene name
pkaC
Definition
PKA family protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     DDB_G0283907 (pkaC)
Protein kinases [BR:ddi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   DDB_G0283907 (pkaC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 648 aa AA seqDB search
MSNSNNNSSSGNHNSTTINNPKVNVYSNIPNSTTYTYGSGGGGTLSGNNTNNNNTNNNNN
NNNNSSGDNKNHSPVTSATDRLTKMDIEEKWDNKNYEKDEREKSPLFHILASNLNSFGNF
KVPSTFSLTPPEPNKQQQPQQQPQQQQPQQQQPQQQQPQQQQQQQPQQQQQPQQQLQQNN
QQQQQQLQQQQLQQQLQQQQQQQQQQQQQQQQKQQKQQQQQQQHLHQDGIVNTPSTTQTS
TTTTTTTTTTNPHTSGLSLQHAHSSYTPSNVLHSPTHFQSSLPTRLDTNPITTPIRQQQQ
SQQQLQQQQLQQIPPPTVNSFFLPPPVNARERLKEFKQIRVIGTGTFGKVYLIQNTKDGC
YYAMKCLNKAYVVQLKQVEHLNSEKSILSSIHHPFIVNLYQAFQDEKKLYLLFEYVAGGE
VFTHLRKSMKFSNSTAKFYAAEIVLALEFLHKQNIVYRDLKPENLLIDNQGHIKITDFGF
AKRVEDRTFTLCGTPEYLAPEIIQSKGHGKAVDWWALGILIFEMLAGYPPFYDDDTFAIY
NKILAGRITFPLGFDVDAKDLIKRLLTADRTRRLGALKDGALDVKNHRWFSDINWERLYQ
RRDNGPFIPKIQHQGDSSNFEMYDEEEMVEEPPSSNYVDPYAHLFKDF
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcaaataataatagctcaagtggtaatcataatagtacaacaataaataac
cctaaagttaatgtatatagcaatataccaaattcaacaacatacacatatggcagcgga
ggaggtggaacactaagtggaaataatactaataataacaacaccaacaataacaataat
aataataataatagtagtggagataataaaaaccatagtcctgtgacctcagcaacagac
cgtttaacaaaaatggatatagaagagaaatgggataacaaaaattatgaaaaagatgaa
agagaaaaatcacctctatttcatatcttggccagtaatttaaatagtttcggtaatttc
aaagttccgagtacattttctttaacaccaccagaaccaaacaaacaacaacaaccacaa
caacaaccacaacaacaacaaccacaacaacaacaaccacaacaacaacaaccacaacaa
caacaacaacaacaaccacaacaacaacaacaaccacaacaacaactacaacaaaataac
caacaacaacaacaacaactacaacaacaacaactacaacaacaactacaacaacaacaa
caacaacaacaacaacaacaacaacaacaacaacaaaaacaacaaaaacaacaacaacaa
caacaacaacacctacatcaagatggtattgtaaatacaccaagtacaacacaaacttct
actacaaccacaacaactacaactacaacaaatcctcatacatctggtttatcattacaa
catgcacattcatcatatacaccttcaaatgtattacattcgccaacacatttccaatca
agtttaccaacaagattggatacaaatccaataacaacaccaatcagacaacaacaacag
tctcaacaacaacttcaacaacaacaattacaacaaattcccccaccaactgtaaattca
ttctttttaccaccaccagtcaatgcaagagaaagattaaaagaatttaaacaaattcgt
gttattggtactggaacatttggaaaggtatatttaattcaaaacaccaaagatgggtgt
tactatgccatgaagtgcttaaacaaggcatacgttgtacaattgaaacaagtagagcat
ttaaattcagagaaatcaattctctcatccattcatcatccattcattgtaaatttgtat
caagcttttcaagatgaaaagaaactgtacctcctctttgagtatgtcgcaggcggtgag
gtgtttactcatttaagaaaatcaatgaagttttcaaatagtaccgccaagttttacgca
gcagagatagtgttggcattggagtttttacataaacaaaatatagtttacagagattta
aaaccagagaatttgttgatcgataatcaaggtcacattaaaatcactgattttggtttc
gcaaaacgggtagaagacagaactttcaccctttgtggtacccctgaatatttggcacct
gaaatcattcaaagcaaaggtcatggtaaagcggtcgattggtgggcacttggtattcta
atatttgaaatgttggcaggttatccacctttctatgatgatgatacctttgcaatctat
aataaaattttggctggtagaatcacttttccattaggttttgatgttgatgctaaagat
ttaattaaaagattattaactgctgatagaactcgtagattgggtgctttaaaggatggt
gcattagatgtcaaaaatcatagatggttttctgatattaattgggaaagattatatcag
agaagagataatggaccattcattccaaagattcaacatcaaggtgattcttcaaacttt
gaaatgtatgatgaagaagaaatggttgaagagcctccatcttcaaattatgttgatcca
tatgcacatcttttcaaggatttttaa

DBGET integrated database retrieval system