KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284037Help
Entry
DDB_G0284037      CDS       T00245                                 

Gene name
DG1039
Definition
MPN/PAD-1 domain-containing protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    DDB_G0284037 (DG1039)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DDB_G0284037 (DG1039)
Peptidases [BR:ddi01002]
 Metallo Peptidases
  Family M67
   DDB_G0284037 (DG1039)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 715 aa AA seqDB search
MAAELPFYIASSVEELVKKHVEGVEVDKNYSIFHYLSTCNNLVKQADIYKSEGDIERTYI
YSLRFCILIFEKLQKHPDFNKESFTKSRNEIKRKAELKLKELEGLKETLKKGYERIQHKK
EEERKRIEREKEKERIFKQEKLKLEREQQLLREEEEQRKREDLELESEIQRLKEVEDFEN
RKLQAQKNIKRATSARTFELLRQEALLEERKRLQGIETEKKRILAEKQEALEKEFQQQLF
EQQEKERLEKERLEKEEQLRLASLPPPPPDYSSFDSDQLLNLIENNNKKLENNNQTDDKL
DNEFLLDPSFLPPPPPIITQPSPSQEKKDNNNNNNNKNTTAQLPLSITQPPHMPNNEKKL
PPIYNSTSPIQFGYPSLNNSVNNPPSFSLQNNTPLIQQYKQQQQQQPIQSPTNNINRPNI
PQYNNYNAKPLSSNLNPLPPQYQPQQQQQYQQQQQQQQYQQQQQYQQQQQQQQQQQQQQQ
HQLPKLPQYQPIENKSISANGLAQSPAVNTPSITPTTNKPNIDSSEASKKYSKLRKIIVH
GEVFQEFMRLAENNTKRSIETCGILSGTLSNDVFRITTIIIPKQEGTTDTCNTIEEHEIF
EYQLENDLLTLGWIHTHPTQDCFLSAVDVHTHCSYQYLLQEAIAVVISPMANPNFGIFRL
TDPPGLETVQKCKLKSFHPHPPVNGIPIYTKVDHVDLIWGKKSDSKVVDLRFLKK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagaattaccattttatattgcttcatcagttgaagagttggtgaaaaaacat
gtggaaggtgttgaagtcgataaaaactattcaatttttcattatttatcaacttgtaat
aatttagtaaaacaagcagatatttataagtctgaaggtgatattgaaagaacttatatt
tattcattaagattttgcattttaatttttgaaaagttacaaaaacatccagatttcaat
aaagaatcatttacaaaatcaagaaatgaaataaaaagaaaagcagaattgaaattaaaa
gaattagaaggtttaaaagaaactcttaaaaaaggttatgaaagaatacaacataaaaaa
gaagaagaaagaaaaagaattgaaagagaaaaagaaaaagaaagaatttttaaacaagaa
aaattaaaattagaaagagaacaacaattattgagagaagaggaagagcaaagaaaaaga
gaggatttagaattagagagtgagatacaaagacttaaagaggtggaagattttgagaat
aggaaactacaagctcaaaagaatattaaaagagcaacttcagctagaacatttgaactt
ttaagacaggaagcattattagaggaaagaaaaaggttacaggggattgaaactgagaaa
aagaggattttagcagagaaacaagaagcattggaaaaggaattccaacaacaactcttt
gaacaacaagaaaaagaaagattagaaaaagaaagattagaaaaagaagaacaattaaga
ttagcttctttaccaccaccaccaccagattattcttcatttgattctgatcaattatta
aatttaattgaaaataataataaaaaattagaaaataataatcaaaccgatgataaatta
gataatgaatttttattagatccttcatttttaccaccaccaccacctataattacacaa
ccatcaccatctcaagaaaagaaagataataataataataataataataaaaatactaca
gcacaattaccattatcaattacacaaccaccccatatgccaaataatgaaaagaaatta
ccaccaatttataattcaacttcaccaattcaatttggttatccttctttaaataatagt
gtaaataatccaccatcattttcattacaaaataatacaccacttatacaacaatacaaa
caacaacaacaacaacaacctattcaatcaccaacgaataatattaatagacctaatata
cctcaatataataattataatgcaaaaccattatcgagcaacctaaacccattaccacca
caatatcaaccacaacaacagcaacaatatcaacaacaacaacaacaacaacaatatcaa
caacaacaacaatatcaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
catcaattaccaaaattaccacaatatcaaccaattgaaaataaatcaatatcagcaaat
ggattagcacaatcaccagctgtgaatacaccatcaataacaccaacaactaataaacca
aatatcgattcatctgaagcatcaaagaaatatagtaaacttagaaaaattattgtacat
ggtgaagttttccaagagtttatgagattagcagagaataataccaaaagatcaattgaa
acttgtggtattttatcgggtactctatcaaatgatgtttttagaatcactacaatcatt
ataccaaaacaagagggtactactgatacttgtaataccattgaagaacatgaaatcttt
gaatatcaactagagaatgatttactaactttgggttggattcatactcatccaactcaa
gattgtttcttatcagccgttgatgtccatactcattgttcctatcaatatcttcttcaa
gaggctatagccgttgtcattagtccaatggcaaatccaaactttggtatctttagatta
accgatccacccggtttggaaactgtacaaaaatgtaaactaaaatcattccatccccat
ccacccgttaatggtataccaatctatacaaaagttgatcatgtcgatttaatttggggt
aaaaaatctgatagtaaagttgtagatttacgttttttaaagaaataa

DBGET integrated database retrieval system