KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284141Help
Entry
DDB_G0284141      CDS       T00245                                 

Gene name
atp7a
Definition
P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 985 aa AA seqDB search
MGDYIQLEVLDKKVEEFPDGASIPKEKKAIFSVQGMTCSSCVGIIESFVSNVEGVISIQV
ALLQETAEVKFNPLILSEDDIVEQISMVGFEAKHLVQAENNTIVLNIGGMTCSSCVGIIE
NYVSNVDGVIECRVNLAMETARVVYDPDLTGVRDIIRNIEDVGFTAQIPSQNFDDTKNIQ
KEEAEKLKKNLIFSTFFTVPVFLIGMVLHKISFFNFLYTNNILHGISYADSIMLCLTTPV
QFLVGKRFYVNGYKSLKHGGANMDVLVALGTSCAYFYSLMVLLMDYTSEDGGSTVGMKTF
FDTSASLITFILLGKYLEVIAKGKTSEAIKKLMGLQATKALLLTIDQNEGGGGGGGSDNK
TTTTILEEREIDIDLVQRGDYLKVLPGSKVPTDGIVVSGLSHIDESIITGESLPVSKKSG
DKLIGGTLNQKGVLVMKATRIGGETSLSQIIKLVEKAQTERAPIQSLADKVSGYFVPSVI
TLGLLTFIVWLIAGSSGVASDYIKASNSSVFQFALRNAISVIVIACPCALGLATPTAVMV
GTGIGAQNGILIKGGSHLETAHKISAIIFDKTGTLTTGKPIVSNVNIFGNLNNNNNGNNN
SGKINKKTFFQMVASAEAASEHPLAGAIVNYAFEVCDVQSTTPPLSFESITGSGIRATLA
PNNIEIMIGNLKWIKSEGISYDPTLTISPDRSINNNHHHNDDDDDDEGTLSHIEDQVRRL
ESDGNTVVYVVIDRQLMGYIAISDQLKPEAHATITELNKMGICTWMVTGDNPRTANAIAQ
QVGIDQVFAEVLPSNKSKKVMELKKMGHTVAMIGDGINDSPALAEADVGIAIGAGTDIAI
EAADIVLVKSDLRDVITAISLSKTTFNRIRFNYLWATLYNILGIPLAAGLLIPFGISIPP
MMAGLAMAFSSISVVLSSLHLKTYQKPDIPIHSRTTEETRQRIHKEQSQLFKKNKIIFES
SPTISSKSNNKIEKLSLLSDHDNIV
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgggagattacattcaattagaagttttagataaaaaggttgaagaatttccagatgga
gcatcaataccgaaagaaaaaaaagccatttttagtgtacagggtatgacatgttcatca
tgtgttggaattatagagagttttgtttcaaatgttgaaggtgtaatctcaatacaagtt
gcattacttcaagaaactgctgaagttaaatttaatccattaattttaagtgaagatgat
atagttgaacaaatttcaatggttggatttgaagctaaacatttagtacaagcagagaat
aatacaatagttttaaatattggaggtatgacatgttcatcatgtgttggaattatagag
aattatgtttcaaatgttgatggtgtaatcgagtgtagagtgaatttagcaatggaaacg
gcaagagttgtatatgatccagatttaactggtgttagagatatcattagaaatattgaa
gatgtaggtttcactgctcaaataccttctcaaaattttgatgatactaaaaatattcaa
aaagaagaagctgaaaaattaaagaaaaatttaatatttagtacattttttactgtacct
gtatttttaattggaatggttttacataaaattagttttttcaattttttatatacaaat
aatattttacatggtataagttatgcagattcaattatgttatgtttaacaacaccagtt
caatttttagttggtaaaagattttatgttaatggttataaatcattaaaacatggtggt
gccaatatggatgtattggtagcattgggtacaagttgtgcttatttctatagtttaatg
gtattgttaatggattatacttcagaggatggtggtagtacagttggaatgaaaacattt
tttgatacttctgcatcattgataacttttattttattaggtaaatatttagaagtgatt
gcaaaaggaaaaacatcagaagcaattaaaaaattaatgggtttacaagctacaaaagca
ttattattaacaattgatcaaaatgaaggtggtggtggtggtggtggtagtgataataaa
actacaacaactatattagaagaaagagaaattgatattgatttagttcaacgtggtgat
tatttaaaggtattaccaggaagtaaagtaccaaccgatggtattgtagttagtgggtta
tcacatatagatgaatcgattatcactggtgaaagtttaccagtttcaaagaaatctggt
gataaattaattggtggtacattaaatcaaaagggtgtgttagttatgaaagcaactaga
atcggtggtgaaacttcattatcacaaatcattaaattggttgaaaaagctcaaacagag
agagccccaattcaaagtttagccgataaagttagtggttatttcgttccatcagtgatt
acattgggtttattaacattcatagtttggttaattgctggttcatctggtgttgcctct
gattatataaaagcatcaaatagttcagtatttcaattcgctctaagaaatgcaatctct
gtaattgtaatcgcatgtccatgtgcattgggtttggctacaccaacggctgttatggtt
ggtactggtattggtgctcaaaatggtattttaattaaaggtggtagtcatttagaaaca
gctcataaaatttcagcaatcattttcgataaaactggtacattaacaactggtaaacca
attgtatcaaatgtaaatatttttggtaatctcaacaacaacaacaatggtaataataat
agtggtaaaataaataaaaaaacattctttcaaatggttgcatcagcagaagctgcatct
gaacatccattagcaggcgcaattgtaaattatgcatttgaagtttgtgatgttcaatca
acaacaccaccactatcattcgaatcaataactggtagtggtattcgtgcaactttagca
cctaataatattgaaattatgattggtaatttgaaatggataaagagtgaaggtatttca
tatgatccaacattaactattagtccggatagatcaataaacaacaaccaccaccacaat
gatgatgatgatgatgatgaaggaacattatcacacattgaagatcaagtaagaagatta
gaatctgatggtaatacagttgtttatgttgtaattgatagacaattaatgggatatatt
gcaatctctgatcaattgaaaccagaagcacatgcaaccattacagagttgaataagatg
ggaatttgtacttggatggtaacaggtgataatccaagaactgcaaatgctatagctcaa
caggttggtatcgatcaagtgtttgcagaggtattaccatcgaataaatcaaagaaagtt
atggaattgaaaaagatgggtcacacagtggcaatgattggcgatggaattaatgacagt
cccgctttggcagaggctgatgtcggtattgcaattggtgctggcactgatatcgcaatc
gaagcagctgatatagttttggttaaaagtgatcttagagatgtaatcactgcaattagt
ttatcgaaaactacattcaatcgtattcgtttcaattatctttgggcaacactttataat
atattaggtataccattagctgctggtttactcataccatttggtatttcaattccacca
atgatggctggtttagcaatggctttctcttcaatcagcgtcgtactttcttcacttcat
ttaaaaacttatcaaaaaccagatattccaattcattctcgtacaaccgaagaaactaga
caaagaattcataaagagcaatcacaacttttcaagaaaaataaaatcattttcgaatca
tctccaacaatctcttcaaagagtaataataaaattgaaaaattatcattattatcagat
catgataatattgtataa

DBGET integrated database retrieval system