KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284259Help
Entry
DDB_G0284259      CDS       T00245                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DDB_G0284259
Enzymes [BR:ddi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DDB_G0284259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 907 aa AA seqDB search
MANFIRFKVNYFTRLGQELYVSGSTEPLGNWDESKATKLTYCDNGDWETLIQFPASNNKV
DYKYFVMDTNGEKIWESGSNRTFNLNDLNSNYIHEFRDTYQSPTSAENTYLNSSFFREVL
FGRENPTQYSLIKQTQADKVIIHFQVKSTYVPPNHSIYIVGSNTQLGNWRTDRAVKLSDE
SYPIWKVDLEFSKDQLPFSYKYIIADKIKSVVHWEYGNDRWFTASATHASEYSSTTNEDR
DFFFNDGEFKDSQLLRSAGVAVPIFSLRSKQGLGIGEFNDLHQLVDWSHQSGLHMIQILP
INDTTVYYTWRDSYPYSSVSVYALHPIYIHIDSITKDPKILAQVNEHREKLNKLTTVDYE
AVMNLKSKLLREIYSKEKASLDGNKEFLQFVKDSEDWIKAYALYSVLRDTYKSGDFDQWP
VYSSITPEDIEKESKPNSKYYDDMRYYYFVQFHLHNQLLAASKYASAKRIGLKGDLPIGV
NRVSVDAWVSPHLFRMNMSTGAPPDAFADDGQNWGFPTYNWEVMKKDGYAWWRSRLGQMS
KYFHAFRIDHILGFFRIWEIPTTCVTGLLGKFNPSLPLWRSELQNNGLWDIDRLTQPYIR
YHTLRELFGEYADSVATKFLVEYSSNCFNMKPEFATERLIEKNLNEEDAMYKSGLFKLVQ
NVSLLADAEDENRFYPRIEITKTSNFNELSDDIKTILHRLYISYYYERQEELWAQIALQR
LPLIKGCTKMLVCGEDLGMVPKCVEPVLNDLGILGLRIQRMPSDSNKDFYHPNEYSYLTV
NTTSSHDMSTLRGWWEEDRARSQVFYNKILGMFGDAPYFCEPYVSEAVITQHLHSQSMIS
IFPIQDWFGISSEYGSRDPKEEKINEPSNPMHYWRYRMHINLETLVNDHDFSKNIQRLIL
SSNRNLD
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactttattagattcaaagttaactatttcacaagattaggacaagagttatat
gtatcaggatcaactgaaccattaggaaattgggatgaatcaaaagccaccaaattaacc
tactgcgataatggagattgggaaactttaattcaatttccagcatcaaacaataaagta
gattataaatactttgttatggatactaatggtgaaaagatttgggagagtggttcaaac
cgtacctttaatttaaatgatttaaattcaaattatattcatgaatttagagatacttat
caaagtccaacatcagctgaaaatacttatttgaattcttcattctttagagaagtactc
tttggaagagaaaatccaactcaatattctttaattaaacaaactcaagctgataaagtt
ataattcatttccaagttaaatcaacatatgtaccaccaaatcattcaatttatattgtt
ggtagtaatacacaattaggtaattggagaacagatagagcagttaaattaagtgatgaa
agttatccaatttggaaagttgatttagagttttcaaaagatcaattaccattctcttat
aaatatattattgccgataagattaaatcagttgttcattgggaatatggtaatgataga
tggttcacagcaagtgccactcatgcaagtgaatattcaagtaccaccaatgaggatcgt
gatttcttctttaacgatggtgaatttaaggatagtcaattattaagaagcgcaggtgtt
gcagtaccaatcttctcattaagaagtaaacaaggtttaggtattggtgaattcaacgat
ttacatcaattggtggattggtcacatcaatcaggacttcatatgattcaaatattgcca
atcaatgataccaccgtctattatacatggagagatagttatccatatagttctgtatcg
gtttatgcacttcatccaatttatattcacattgattcaataaccaaggatccaaagata
ttggctcaagtaaatgaacatcgtgaaaaattaaataaattaacaactgtagactatgaa
gccgttatgaatttgaaatcaaaattattacgtgaaatctattcaaaagaaaaggcatca
ttggatggaaacaaagagtttttacaatttgtaaaggatagtgaagattggattaaagct
tacgctttgtatagtgtcttacgtgacacctataagagtggagatttcgatcaatggcca
gtctatagtagtatcactcctgaagacattgaaaaggaatccaaaccaaactcaaaatac
tatgatgatatgcgttattattatttcgttcaattccatcttcacaatcaattgctagcc
gcttcaaaatatgcatcagctaaaagaatcggtttaaaaggtgatttaccaattggtgtc
aatagagtatcagttgatgcttgggtatcaccacatttattccgtatgaatatgtcaact
ggtgcaccacctgatgctttcgctgatgatggtcaaaattggggtttcccaacttacaat
tgggaagtcatgaaaaaggatggctatgcttggtggcgttcacgtttgggtcaaatgtca
aaatatttccatgcatttagaatcgatcatatcttgggtttctttagaatttgggagatt
ccaaccacttgtgtcactggtttattgggtaaattcaatccatcattaccattgtggaga
agtgaacttcaaaacaatggtctttgggatatcgatcgtttaactcaaccatacattcgt
tatcatactcttagagagttatttggtgaatacgccgattctgtcgcaactaaattcctc
gttgaatattcaagcaattgtttcaatatgaaaccagagtttgccactgagcgtctcatt
gaaaagaatctcaatgaagaggatgcaatgtataaatctggtctctttaaattggttcaa
aatgtaagtctcttggccgatgcagaggatgaaaatcgtttctatccaagaattgaaatc
accaaaactagcaatttcaatgaactctctgatgatatcaagaccattctccatcgttta
tacatctcttactactatgaaagacaagaggaactttgggcacaaattgctcttcaacgt
ttacctttgattaaaggttgcacaaagatgttggtttgtggtgaagatttaggtatggtt
ccaaaatgtgttgagcctgtactcaacgatttaggtatccttggtttaagaattcaacgt
atgccttccgattcaaataaagatttctatcatccaaatgaatattcctatctcactgta
aatactacctcatctcatgatatgagtaccttgagaggttggtgggaagaagatagagct
cgttctcaagttttctacaataaaatcttgggaatgtttggtgatgctccttacttttgt
gaaccttatgttagtgaggccgttatcactcaacatttacattctcaatctatgatttca
atctttccaattcaagattggttcggtatctctagtgaatatggtagcagagatccaaaa
gaagaaaagattaatgaaccttcaaatccaatgcattattggagatatcgtatgcatatc
aatttagaaaccttggttaacgatcatgatttcagtaaaaatattcaaagattaatttta
tcttcaaatcgtaatttagattaa

DBGET integrated database retrieval system