KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284407Help
Entry
DDB_G0284407      CDS       T00245                                 

Gene name
erg24
Definition
Delta-sterol reductase
Orthology
K00222  
delta14-sterol reductase [EC:1.3.1.70]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    DDB_G0284407 (erg24)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     DDB_G0284407 (erg24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 462 aa AA seqDB search
MSAVRNRNNVEKQSNNGAQLTEVQKKELADLQKVHPANEFGGIIGTFLLTFILPVVVYWI
WASIEFNNGYLLRPETLSVEGVKAFLAQLYHYVITYAYPTKEAAIIYFSWFGFQAFLQHV
VPGRKVLGSPLPGGARLEYTLNGWASWWITLIVIPIAIYFGLFKATILIDNYAPMMTVVN
IWSFVFTFLLKIHAKLKGEEERMSGHFFYDFWMGFARNPRIGSFDLKLFCEARPGLILWV
LMNFSIAAKQLEVYGEISLSVILVCCFHFWYIADYYYHEEAILTTMDIITEKFGYMLVYG
DLSWVPFTYCFQCYYLYKHLVNGAPLHISIGYAIFVVSLKCFGFYLFRWVNSQKHDFRRN
PEAPVWGKPAEFILTKRGTKLLCSGFWGICRHLNYTGDIILSWAWCLPCQFDSLAPYFYG
IYFTSLDLHRCWRDHNACLVKYGDDWRAYCKRVPYNFIPGLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagttagaaatagaaataacgttgaaaagcaatcaaacaatggtgctcaatta
acagaagtccaaaagaaagaattagccgacttacaaaaagttcatccagctaatgaattc
ggtggtattattggtaccttcctcttaacttttattctcccagttgttgtctattggatt
tgggcatcaattgaattcaacaatggttatctcttacgtccagaaaccctttcagtcgaa
ggtgtcaaagcattcttggctcaactctaccactatgtcatcacttacgcctacccaacc
aaagaagcagccatcatctacttctcatggtttggtttccaagcattccttcaacacgtt
gttccaggtcgtaaagttttaggttcaccattaccaggtggtgctcgtctcgaatacacc
ctcaatggttgggcttcatggtggatcacactcattgtcatcccaattgccatctatttc
ggtctcttcaaagccaccatcctcattgacaactacgccccaatgatgaccgtcgtcaac
atttggtcctttgttttcactttcctcttaaaaatccacgccaaattaaagggtgaagaa
gaacgtatgtcaggtcacttcttttacgatttctggatgggttttgctcgtaatccacgt
atcggttcattcgatctcaaacttttctgtgaagctcgtccaggtctcatcctttgggtt
ttaatgaatttctcaattgctgccaaacaactcgaagtctacggtgaaatttcactctct
gtcatcttggtttgttgtttccacttctggtacattgccgattactattatcacgaagaa
gccatccttaccactatggatatcatcactgaaaaattcggttacatgttagtttatggt
gatttatcatgggtcccattcacctattgtttccaatgttactacctctacaaacattta
gtcaacggtgctccattacacatctctattggttacgccatctttgttgtctctttgaaa
tgtttcggtttctatctcttccgttgggttaactcacaaaaacacgatttccgtcgtaat
ccagaagctccagtttggggtaaaccagctgaattcatcctcaccaaacgtggtactaaa
ttattatgctctggtttctggggtatttgccgtcatcttaactacactggtgatattatc
ttatcatgggcttggtgtcttccatgtcaattcgattcacttgctccatacttttatggt
atttactttacttcattagatctccaccgttgttggagagatcataatgcttgtttagtt
aaatatggtgatgattggagagcttattgtaaacgtgttccatacaatttcattccaggt
ttaatttaa

DBGET integrated database retrieval system