KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285071Help
Entry
DDB_G0285071      CDS       T00245                                 

Gene name
echs1
Definition
enoyl Coenzyme A hydratase, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DDB_G0285071 (echs1)
   01212 Fatty acid metabolism
    DDB_G0285071 (echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0285071 (echs1)
   00650 Butanoate metabolism
    DDB_G0285071 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0285071 (echs1)
   00071 Fatty acid degradation
    DDB_G0285071 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DDB_G0285071 (echs1)
   00310 Lysine degradation
    DDB_G0285071 (echs1)
   00380 Tryptophan metabolism
    DDB_G0285071 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0285071 (echs1)
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DDB_G0285071 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 277 aa AA seqDB search
MLKQVIKTVSSSQAPKKYFFKQFCTSTTEKKGRVGLVTLNRPKSLNALSDGLISEINSAV
KLFQEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHDLTKIRKPIIAA
VNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGKSKAMELVL
TGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVNASYELTLQ
EGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTWHNK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacaagttattaaaacagtatcaagctcacaagcaccaaagaaatatttcttt
aaacagttttgtacatcaacaacagaaaagaaaggtcgtgttggtcttgttactttaaat
agaccaaaatcattaaatgcactttctgatggtttaatttcagaaattaacagtgctgtt
aaactcttccaagaagataaagatgttggttcaatcattatcactggtagtgaaaaagca
tttgctgctggtgcagatattaaagaaatggaaaaagttacattaccagatgcttacaat
aatgatcttttagcacaatggcatgaccttaccaagattcgtaaaccaattattgcagct
gtaaatggttatgcattaggtggtggttgtgaattagcaatgatgtgcgatattattatc
gctggtgaaaaagcagtatttggtcaaccagagattaaattaggtactattccaggttgt
ggtggtacacaacgtttaattagagcaattggtaaatcaaaagctatggaattagtttta
acaggtaataatttaactgcagttgaagctgaaaaagctggtttagttagtaaagttgtt
ccagttgaagaacttttaactgaagccactaaaatggctgaaaaaatcgcttcttattct
caattaactgttgcaatggcaaaagaagcagtaaatgcatcatatgaattaactcttcaa
gaaggtattagattcgaacgtagaatgttccattctacttttggtactcatgaccaaaaa
gaaggtatgaacgcttttgttgaaaagagaactccaacatggcacaacaaataa

DBGET integrated database retrieval system