KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285071Help
Entry
DDB_G0285071      CDS       T00245                                 

Gene name
echs1
Definition
enoyl Coenzyme A hydratase, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ddi01200]
Metabolism; Overview; Fatty acid metabolism [PATH:ddi01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ddi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ddi00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ddi00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ddi00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ddi00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ddi00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ddi00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ddi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
Position
4
AA seq 277 aa AA seqDB search
MLKQVIKTVSSSQAPKKYFFKQFCTSTTEKKGRVGLVTLNRPKSLNALSDGLISEINSAV
KLFQEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHDLTKIRKPIIAA
VNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGKSKAMELVL
TGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVNASYELTLQ
EGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTWHNK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacaagttattaaaacagtatcaagctcacaagcaccaaagaaatatttcttt
aaacagttttgtacatcaacaacagaaaagaaaggtcgtgttggtcttgttactttaaat
agaccaaaatcattaaatgcactttctgatggtttaatttcagaaattaacagtgctgtt
aaactcttccaagaagataaagatgttggttcaatcattatcactggtagtgaaaaagca
tttgctgctggtgcagatattaaagaaatggaaaaagttacattaccagatgcttacaat
aatgatcttttagcacaatggcatgaccttaccaagattcgtaaaccaattattgcagct
gtaaatggttatgcattaggtggtggttgtgaattagcaatgatgtgcgatattattatc
gctggtgaaaaagcagtatttggtcaaccagagattaaattaggtactattccaggttgt
ggtggtacacaacgtttaattagagcaattggtaaatcaaaagctatggaattagtttta
acaggtaataatttaactgcagttgaagctgaaaaagctggtttagttagtaaagttgtt
ccagttgaagaacttttaactgaagccactaaaatggctgaaaaaatcgcttcttattct
caattaactgttgcaatggcaaaagaagcagtaaatgcatcatatgaattaactcttcaa
gaaggtattagattcgaacgtagaatgttccattctacttttggtactcatgaccaaaaa
gaaggtatgaacgcttttgttgaaaagagaactccaacatggcacaacaaataa

DBGET integrated database retrieval system