KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285071Help
Entry
DDB_G0285071      CDS       T00245                                 

Gene name
echs1
Definition
(RefSeq) enoyl Coenzyme A hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi00071  Fatty acid degradation
ddi00280  Valine, leucine and isoleucine degradation
ddi00310  Lysine degradation
ddi00380  Tryptophan metabolism
ddi00410  beta-Alanine metabolism
ddi00640  Propanoate metabolism
ddi00650  Butanoate metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
ddi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0285071 (echs1)
   00650 Butanoate metabolism
    DDB_G0285071 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0285071 (echs1)
   00071 Fatty acid degradation
    DDB_G0285071 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DDB_G0285071 (echs1)
   00310 Lysine degradation
    DDB_G0285071 (echs1)
   00380 Tryptophan metabolism
    DDB_G0285071 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0285071 (echs1)
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DDB_G0285071 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-GeneID: 8624884
NCBI-ProteinID: XP_001134539
dictyBase: DDB_G0285071
UniProt: Q1ZXF1
Position
4
AA seq 277 aa AA seqDB search
MLKQVIKTVSSSQAPKKYFFKQFCTSTTEKKGRVGLVTLNRPKSLNALSDGLISEINSAV
KLFQEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHDLTKIRKPIIAA
VNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGKSKAMELVL
TGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVNASYELTLQ
EGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTWHNK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacaagttattaaaacagtatcaagctcacaagcaccaaagaaatatttcttt
aaacagttttgtacatcaacaacagaaaagaaaggtcgtgttggtcttgttactttaaat
agaccaaaatcattaaatgcactttctgatggtttaatttcagaaattaacagtgctgtt
aaactcttccaagaagataaagatgttggttcaatcattatcactggtagtgaaaaagca
tttgctgctggtgcagatattaaagaaatggaaaaagttacattaccagatgcttacaat
aatgatcttttagcacaatggcatgaccttaccaagattcgtaaaccaattattgcagct
gtaaatggttatgcattaggtggtggttgtgaattagcaatgatgtgcgatattattatc
gctggtgaaaaagcagtatttggtcaaccagagattaaattaggtactattccaggttgt
ggtggtacacaacgtttaattagagcaattggtaaatcaaaagctatggaattagtttta
acaggtaataatttaactgcagttgaagctgaaaaagctggtttagttagtaaagttgtt
ccagttgaagaacttttaactgaagccactaaaatggctgaaaaaatcgcttcttattct
caattaactgttgcaatggcaaaagaagcagtaaatgcatcatatgaattaactcttcaa
gaaggtattagattcgaacgtagaatgttccattctacttttggtactcatgaccaaaaa
gaaggtatgaacgcttttgttgaaaagagaactccaacatggcacaacaaataa

DBGET integrated database retrieval system