KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285117Help
Entry
DDB_G0285117      CDS       T00245                                 

Gene name
rad54b
Definition
CHR group protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DDB_G0285117 (rad54b)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     DDB_G0285117 (rad54b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 989 aa AA seqDB search
MKKSSKGFVSPYKDSNTTSTPSINHLASKPKKITTSTTSTTSTTTTSSSSSPIETQKTKS
KANSSSNNNDKSEDKTNDGELIHYKIGWCAKSTKKHKIYNDGYLMYDQDKKIFTLYDDCG
KENGKSVTVNIQDVKPDTKVFISSKEVLIEHIITSKEFEKATGLESSLVSNSTSSSSLST
TTIRKLSKKQQKLQEEEEEKQQQQQDEKQTTNINKSTIKKEFKSHTSLEEQKSSKKIVCP
HDPNSKDALIFYSPPPSQLDEEGNKVVHVVLDPYIGRHLRPHQRRGVKFLYDCVTGNSND
NGYSGAILADQMGLGKTLQTLALLWTLLKQSPYGKPTIKKAIIVTPSTLVNNWKSEIQKW
FGNGRLIASTLTDSLTKETKANLNDFNTSIKPVLIISYEQCRIFSKELETMSCGLMVCDE
AHRLKNSNAKTTQSIMSVRCDRKILLTGTPIQNNLVEFYSMMDFANPNCLGSLADFKKSF
IIPINKSRESPNSTSTSEGIRKSIQLSKLVKPFIIRRKSNILEKYLPPKRVQIIFCKLSS
LQIELYKSILNSNSVKSLLSGGGSRGSATSLSTITLLKKLCNSPSLLLLNNKQDEGGEQQ
QTEIQNILKKHNYTLENYQEIQEQQDNESGKLLFVESLIKQLKPMNEKLVLVSNFTKTLD
VFERLCKRLSIDTLRLDGDVKADSRQALVDKFNSSTQNVSSSKSSSSQYQVFLLSAKAGG
VGINLIGGNHLVLYDPDWNPAIDIQAMERIWREGQTKPVFIYRLFSTGTIEEKIYQRQLM
KESISNSIVDKKFNDNGGNFSLEDLKDIFSYNENTNSDTHDLLQCNCGNSNSNASTSINI
KRIEIFKTIQHLDKWEHYRDVDQFSKQCNHDSILKKLKSKQDPISFIFISKTPIPSNNDL
DDDQNDDDDFSFLEVENQIEDEEEDNNQQNTTPSKKRSNKKKEVDEEEEQEEEGEEEEET
NPQTNLRKRAKINIVEDNDDDDLSDLDMS
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtagcaaaggatttgtttcaccttacaaagattcaaacacaacatcaact
cctagcattaatcatttagcatcaaaaccaaaaaaaataacaacatcaacgacatcaaca
acttcaacaacaacaacatcatcatcatcatctcctatagaaacacaaaaaacaaaatcg
aaagcaaatagtagtagcaataataatgataaaagtgaagataaaactaatgatggagaa
ttaattcattataaaattggttggtgcgcaaaatcaactaaaaaacataagatttataat
gatggttatttaatgtatgaccaagataaaaaaatatttacattatatgatgattgtggt
aaagagaatggaaagagtgtaacagtgaatatacaagatgttaaaccagatacaaaagta
ttcatctcttcaaaagaagtattaattgaacatataattacaagcaaagaatttgaaaaa
gcaactggtttagagtcatctttagtttcaaattctacatcatcatcatcactatcaaca
acaacaattagaaaactaagtaaaaaacaacaaaaacttcaagaagaagaggaggaaaaa
caacaacaacaacaagatgaaaaacaaacaacaaatattaataaatcaacaattaaaaaa
gaatttaaaagtcatactagtttagaagaacaaaaaagttcaaaaaagattgtttgtcca
catgatccaaattcaaaggatgcattaatattttattcaccaccaccaagtcaattggat
gaagaaggtaataaagttgttcatgttgtattggatccatatattggtagacatttaaga
cctcatcaaagaagaggtgttaaattcctttatgattgtgttacgggtaattcaaatgat
aatggatacagtggtgctattttagctgatcaaatggggttaggtaaaacattacaaact
ttagctttactttggacattattgaaacagtcaccatacggcaaaccaacaataaaaaag
gctatcatagttacaccatcgacattggttaacaattggaagagtgaaattcaaaaatgg
tttggcaatggtcgtttgattgcatcaactttaacagattcattaacaaaagagacaaaa
gcaaatttaaatgatttcaatacatcgattaaacccgtattaattatctcttatgaacaa
tgtagaatcttttcaaaggaattggaaacgatgagttgtggtttaatggtttgtgatgaa
gctcatcgtttaaagaattcaaatgcaaagaccactcaatcgataatgagtgttagatgt
gatagaaagattttattaacaggtacaccaattcaaaataatttagtggaattttattca
atgatggattttgctaatccaaattgtttaggttctttagctgactttaaaaaatcattc
atcataccaattaataaatctagagaatcaccaaattcaacttcaacttcagaaggtatt
agaaaatcaattcaactctcaaaattggttaaaccattcatcattagaagaaaatcaaat
attttggagaaatatttaccaccaaaaagagtacaaatcatattttgtaaattatcatca
cttcaaattgaattatataaatcaattttgaattcaaatagtgttaaatcattattatca
ggtggtggtagtagaggttcagcaacttctctttcaacaataacattattaaagaaatta
tgtaattcaccatcattattattattaaataacaaacaagatgaaggaggagaacaacaa
caaactgaaattcaaaatatattaaagaaacataattatacattagaaaattatcaagag
attcaagaacaacaagataatgaatctggtaaattattatttgttgaatcattgattaaa
caattaaaaccaatgaatgaaaaattggtattggtttcaaatttcacaaaaacattggac
gtctttgagagattatgtaaacgattatcaattgatacacttagattggatggtgatgtt
aaagctgattcaagacaagcattggttgataaatttaattctagtactcaaaatgtttca
tcatcaaaatcatcgtcatcacaatatcaagtgtttttgttatctgcaaaagctggtggt
gttggtattaatttaattggtggtaatcatttggttctatatgatccagattggaatcct
gcaatcgatattcaagcaatggaaagaatttggagagaaggtcaaactaaaccagttttc
atctatagattattttcaacaggtacaattgaagagaagatttatcaaagacaattaatg
aaagaatcaatttcaaattcaattgttgataaaaagtttaatgataatggtggtaatttc
tcattggaagatttaaaagatatcttttcttataatgaaaatacaaattcagatactcat
gatttattacaatgtaattgtggtaatagtaatagtaatgctagtactagtataaatatt
aaaagaatagaaatatttaaaactattcaacatttagataaatgggaacactatagagat
gtagatcaattttcaaaacaatgtaatcatgattcaatattaaagaaattgaaatcaaaa
caagatccaatttcttttattttcatttctaaaacaccaataccatcaaataatgattta
gatgatgatcaaaatgatgatgatgatttttctttcttagaagtagagaaccaaattgaa
gacgaagaagaggataataaccaacaaaataccacaccatcaaagaaaagatcaaataaa
aagaaagaagttgatgaggaggaggagcaggaggaagaaggagaagaagaagaagagaca
aatcctcaaaccaatttaagaaagagagcaaaaataaatattgttgaagataatgacgat
gatgatttgtcagatttagacatgtcataa

DBGET integrated database retrieval system