KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285399Help
Entry
DDB_G0285399      CDS       T00245                                 

Gene name
cyb5r1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DDB_G0285399 (cyb5r1)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     DDB_G0285399 (cyb5r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 286 aa AA seqDB search
MQISDFILVIIGSVALAAGVKYVFTLTSGSNKDKKGGEAEKGKQVEKALDPQEYRKFQLK
EKFIVNHNTRIFRFALPNEDDILGLPIGQHISLRAVVGGKEVYRPYTPISSDEERGYFDL
LIKVYEKGAMSGYVDNMFIGDSIEVKGPKGKFNYQPNMRKSIGMLAGGTGITPMLQVIKA
ILKNPSDKTEISLVFGNITEEDILLKKELDELAEKHPQFKVYYVLNNPPKGWTQGVGFVS
KEIIESRLPSPSDQTMVIMCGPPMMNKAMTGHLETIGFNESNIFTF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttcagattttattcttgtaattattggatcagttgcattagcagcaggtgtt
aaatatgtatttactttaacatcaggtagtaataaagataaaaaaggtggtgaagcagag
aaaggtaaacaagttgaaaaagcattagatccacaagaatatagaaagtttcaattaaaa
gagaaattcatagtgaatcataatactagaatctttagatttgcattaccaaatgaagat
gatattttaggtttaccaattggccaacacatttcattgagagcagttgttggtggcaaa
gaagtttatcgtccatatacaccaatttcatcagacgaagagagaggttactttgatctc
ttaatcaaagtctatgaaaagggtgccatgtcaggctacgttgacaacatgttcattggc
gactcaatcgaagttaaaggtccaaaaggtaaattcaactaccaaccaaacatgcgtaaa
tcaatcggtatgttagctggtggtacaggtatcactccaatgttacaagtcatcaaagca
atcttgaaaaatccatccgataaaactgaaatctctttagtctttggtaacatcaccgaa
gaggatatcctcctcaagaaggaattggacgaattggctgaaaaacatccacaattcaaa
gtttactacgttttaaataatccaccaaaaggttggactcaaggtgttggctttgtatct
aaagaaatcattgaatcacgtttaccttctccatctgatcaaactatggttatcatgtgt
ggtccaccaatgatgaataaagcaatgactggtcatttagaaactattggttttaatgaa
tcaaatattttcactttttaa

DBGET integrated database retrieval system