KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285527Help
Entry
DDB_G0285527      CDS       T00245                                 

Gene name
uch2
Definition
peptidase C12 family protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DDB_G0285527 (uch2)
Peptidases [BR:ddi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   DDB_G0285527 (uch2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 343 aa AA seqDB search
MSENEGWCTIESDPGVFTELITKIGVKDIQVEELYTLDSSEYDRLKPVLGLIFLFKWEKE
EENRTISDNENIFFANQVIQNACATQAILSVLLNSEGIELGEELSNFKSFVGDFPPMMKG
EAIGNSELIKETHNSFTVQDPFIFSKKKNRKPSDAFHFISFIPFQGKVYELDGLKKGPYC
LGDCTPDNWLEIATPFIQKRMEKYSQGEIRFNLMAVIKNRQTTLQEKILTLEKKKNDLEI
KLSELNSGSGGDNKEESGGATPTTKEDLNFMINVVNNDIEEANNEILMEQEKFRNWKDEN
IRRKHNFTPLILNLIKGLAEKDNLQPLIQKAKDQISQKQQQHK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaatgaaggatggtgtacaattgaaagtgacccaggtgtattcacagaatta
attacaaaaattggtgtgaaagatattcaagttgaagaattatatacattagactcatca
gaatatgatagattaaaaccagtattaggattaatatttttatttaaatgggaaaaagaa
gaagagaatagaacaatttctgataatgaaaatatattctttgcaaatcaagtcattcaa
aatgcatgtgcaactcaagctatcctttcagttttattaaattctgaaggtattgaattg
ggtgaagaattatcaaattttaaatcatttgttggtgattttccaccaatgatgaaaggt
gaagcaattggtaatagtgaattaattaaagaaactcataatagttttacagttcaagac
ccatttatattttcaaagaaaaagaatagaaaaccatcagatgcattccattttataagt
tttataccattccaaggtaaagtttatgagttggatggtttaaaaaaaggtccatattgt
ttaggtgattgtacccctgataattggttagagattgccactccattcattcaaaaaaga
atggaaaaatatagtcaaggtgaaattagattcaatttaatggctgtaattaaaaataga
caaactacattacaagaaaagattttaactttagaaaagaaaaaaaatgatcttgaaatt
aaattatctgaacttaatagtggtagtggtggtgataataaagaggaatctggtggtgca
acaccaacaacaaaagaagatttaaattttatgataaatgttgtaaataatgatatagaa
gaagcaaataatgaaattttaatggaacaagagaaatttagaaattggaaagatgaaaat
attagaagaaaacataatttcactccattaatcttaaatttaattaaaggtttagctgaa
aaagataatctccaaccattaattcaaaaagcaaaagatcaaatctctcaaaaacaacaa
caacataaataa

DBGET integrated database retrieval system