KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285533Help
Entry
DDB_G0285533      CDS       T00245                                 

Gene name
ppt1
Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DDB_G0285533 (ppt1)
  Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0285533 (ppt1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     DDB_G0285533 (ppt1)
Lipid biosynthesis proteins [BR:ddi01004]
 Fatty acid synthase
  Component type
   DDB_G0285533 (ppt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 303 aa AA seqDB search
MKILFFIILIINCYLIQNSNSENIRPVVLWHGLGDSGLDPLTMGKLKELIENQLPGVYVK
NIAIGDSIAEDSFNSFFKNVNEQLEIVCKMLKEDTNLTSGFNAVGLSQGGQFLRGYVERC
NDPPVYNLISLGGQHQGVSSLPRCTALNSTLCKIADDLVELGVYEKYVQNTLVPGEYWQD
PFNYDEYVEKSVFLADINNVRSEKNQTYKDNLLSVNNFILGEFLADTIVVPRESELFGYY
QPGQDNIILPMEKTDLYIEDWIGIQQLDNEGRLIKISCPGNHLQFTDQWFNQNVIPYLNN
QIN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattattttttattattttaataataaattgttatttaattcaaaattcaaat
agtgaaaatattagaccagttgtattatggcatgggcttggtgattcaggtttagatcca
cttacaatgggtaaattaaaagaattgatagagaatcaattacctggtgtttatgttaaa
aatattgcaattggtgatagtattgcagaagattcttttaattctttctttaaaaatgtt
aatgaacaacttgaaatagtttgtaaaatgttaaaagaagatacaaatttgacatctgga
tttaatgctgttggtttatcacaaggtggtcaatttcttagaggatatgttgaacgttgt
aatgatccaccagtttataatttaatttcattaggtggtcaacatcaaggtgttagttca
ttaccaagatgtactgcattaaattcaacattatgtaaaatagctgatgatttggttgaa
ttaggtgtttatgaaaaatatgttcagaatactttagtacctggtgaatattggcaagat
ccatttaattatgatgaatatgttgaaaaatcagtatttttagcagatattaataatgtt
cgttctgaaaagaatcaaacatataaggataatttattaagtgtaaataattttatattg
ggtgaatttttagcagatacaattgtagttccaagagaatctgaattatttggttattat
caaccaggtcaagataatattatcttaccaatggaaaaaacagatttatacattgaagat
tggattggtattcaacaattagataatgaaggtagattaattaaaatatcatgccctggt
aatcatttacaattcactgatcaatggtttaatcaaaatgtaatcccttatctcaataat
caaattaattaa

DBGET integrated database retrieval system