KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285999Help
Entry
DDB_G0285999      CDS       T00245                                 

Gene name
cnbB
Definition
calcium-binding EF-hand domain-containing protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     DDB_G0285999 (cnbB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 183 aa AA seqDB search
MGVSRSTLRTEEIEEIREVSIFSQREIKRLYKRFKRLDKEEKGSINVEDFNQIPELSMNP
MLPRIISIFDVNRDGQVNFKQFVKSLSTFHPKADKADKIKILFKVYDINNDGFITRDEIE
TILTMMVGSNLTKEQISSIVEETLNEADVNGKGKLDYPDFYNSIGSSGCNAENMLSISFN
PFE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtatctagatctacattaagaactgaagagatcgaggaaatcagagaagtatca
attttttcacaaagagaaattaaaagattatataaaagatttaaaagattagataaagag
gaaaaagggtcaataaatgtagaagattttaatcaaataccagagctatcaatgaatcca
atgttacctagaatcatatctatatttgatgttaatagagatggtcaagttaactttaaa
caatttgtaaaatcattatcaacttttcatccaaaagctgataaagctgataaaattaaa
atattatttaaagtatatgatattaataatgatgggttcataacaagagatgaaattgaa
accattttaacaatgatggttggttcaaatttaacaaaagaacaaatttcaagtattgtt
gaggaaactctcaatgaagctgatgtaaatggtaaagggaaattagactatccagatttc
tataattcaatcggatcatcaggttgtaatgccgaaaatatgctttccatttcttttaat
ccttttgaataa

DBGET integrated database retrieval system