KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286187Help
Entry
DDB_G0286187      CDS       T00245                                 

Gene name
proB
Definition
profilin II
Orthology
K05759  
profilin
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Exosome [BR:ddi04147]
 Exosomal proteins
  Proteins found in most exosomes
   DDB_G0286187 (proB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 124 aa AA seqDB search
MTWQAYVDNNLLGAGFASAALLGAADGSVWAHSAGFNVAEGKAITALFQKDGAAFATGIH
VAGKKYMAIKSDTRSAYGKLGAGGVVCVKTLTCIIVAVYDDKLQPGAAANIAEKLADYLI
DNNC
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacttggcaagcatacgtcgataacaacttacttggtgctggtttcgcatcagctgct
cttttaggtgctgctgacggtagtgtttgggcacactcagctggattcaatgtcgctgaa
ggtaaggcaataaccgcactttttcaaaaggatggagctgcattcgcaactggcatccac
gttgctggtaagaaatatatggccatcaaaagtgacaccagatctgcttacggtaaatta
ggtgctggtggtgttgtttgcgttaaaaccttaacttgtatcatcgttgctgtctatgat
gacaaattacaaccaggtgctgctgctaacattgctgaaaaattagccgattatttaatt
gacaacaactgttaa

DBGET integrated database retrieval system