KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286315Help
Entry
DDB_G0286315      CDS       T00245                                 

Definition
transmembrane protein
Orthology
K10532  
heparan-alpha-glucosaminide N-acetyltransferase [EC:2.3.1.78]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    DDB_G0286315
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.78  heparan-alpha-glucosaminide N-acetyltransferase
     DDB_G0286315
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 675 aa AA seqDB search
MNKVILLFFLFITYSSNLLVQSQTLTNITKYPDTSQLQYDQSYLRICTNLFEQIVNFNTT
LSVEFVYDACYTCEYQNLVVLDSSSSKYIIMPSTFGYKFNISVLYNGKAQDDILYLSFHE
TFGEYGIYDISVNISTVNVTKKIYHSVKTLKEPINSEIPIAVLFSILVGMAILWPFIVYL
YKRSKRDSLEYQLMASVERENRKKDRLRSLDVFRGFSITIMIFVNYGGGGYWFFNHSLWN
GLTVADLVFPWFVFIMGIAMPLSFHAMEKRGTPKRIIFQKLLRRSIILFALGLFINNGVD
LQQWRILGVLQRFSISYLVVGSIMLFVPIWKFRSSPNDTININDGSSGGGGGIGIQSQQQ
HQSQQYNHSSQQYSQQQVFLIPQEVVEQQSILNGPSMNNIKDTDTFVKGNIYMSMIQHET
VISKYFSDIAPYWIQWVFALIIFSGWFLLMFLVPVPGCPTGYLGAGGLADQGRYQHCTGG
AARLIDLKIFTEAHIFQNPTCLEVYKTPSYDPEGTVGYLTSIFLCFIGVQAGRIILTYKS
NRSRLIRWMVWSVVLCGIAAGLCGLTQNQGWLPVNKNLWSPSFILLMAGFGFFVLTVMFI
LIDIKKIWNGSPFIYVGMNPITIYCGHEILGTYFPFSFNVTYQTHSLYLLSNCIGVGCWL
LIAYQMYRNKLFINI
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttatattattattctttttatttataacatatagtagtaatcttttagtt
caatcgcaaactttaacaaatataacaaaatatccagatacatcgcaattacaatacgat
caatcatacttaagaatatgtacaaatctttttgaacaaattgtcaattttaatacaact
ttatctgttgaatttgtttatgatgcatgttatacttgtgaatatcaaaatttagttgtt
ttggattcatcaagttcaaaatatattattatgccaagtacgtttggatataaatttaat
attagtgtattatataatggaaaagcacaagatgatatattatatttatcatttcatgaa
acatttggtgaatatggtatctatgacattagtgtaaacatttctacagtaaatgtaaca
aaaaaaatttatcattcagttaaaacattaaaagaaccaattaattcagagataccaatt
gcagtattattttcaattttagttggtatggcaattttatggccatttatagtttattta
tataagagaagtaaaagagattcattagagtatcaattgatggcaagtgttgaaagagag
aatagaaaaaaagatagattaagatcattggatgtatttagaggattttcaatcacaatt
atgatctttgtgaattacggtggtggtggatattggttctttaatcatagtttatggaat
ggtttaaccgttgcagatttagttttcccatggtttgttttcatcatgggtattgcaatg
ccattatcatttcatgccatggagaaaagaggtacaccaaagagaatcatctttcaaaag
ttattacgtagatcaatcattttattcgcgttaggtttattcataaacaatggtgtcgat
ttacaacaatggagaattttaggtgtacttcaaagattttcaatctcttatttagtggtt
ggttcaattatgttattcgtaccaatatggaaatttagatcttcaccaaatgatactata
aatattaatgatggtagtagcggtggtggtggtggtattggtattcaatcacaacaacag
catcaatcacaacaatataatcattcatcacaacagtatagtcaacaacaggtattttta
atacctcaagaagtggttgaacaacaatcaattttaaatggaccatcaatgaataatatt
aaagatactgatacttttgttaaaggtaatatatatatgtcaatgatacaacatgagact
gtgattagtaaatatttttcagatatagctccatattggattcaatgggtatttgcttta
atcattttttcaggttggttcctattgatgtttttagtgcctgtaccaggttgtccaact
ggttatttgggtgctggtggtttggcagatcaaggtagatatcaacattgtacaggtggt
gctgcacgtttaatagatttgaaaattttcactgaagctcatatctttcaaaatccaaca
tgtcttgaggtttataaaacaccatcctacgatccagaaggtaccgttggttatttaaca
agtattttcctttgttttattggtgttcaagcgggtagaatcattctaacatataagtca
aatagatcacgtttaatacgttggatggtttggtcagtggtactatgtggtatcgctgct
gggttgtgtgggttaactcaaaatcaaggttggttaccagttaataagaatctttggtca
ccatctttcattttgttgatggctggttttggtttctttgttttaaccgtaatgtttatt
ttgattgatatcaaaaagatttggaatggttcaccattcatttatgttggtatgaatcca
atcaccatctattgtggccatgaaattttgggaacttatttccctttctctttcaatgtt
acctatcaaactcattcattatatttactttccaattgtattggtgttggttgttggtta
ttaatagcttatcaaatgtatagaaataaattatttattaatatttaa

DBGET integrated database retrieval system