KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286353Help
Entry
DDB_G0286353      CDS       T00245                                 

Gene name
erkA
Definition
ERK subfamily protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DDB_G0286353 (erkA)
Protein kinases [BR:ddi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   DDB_G0286353 (erkA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0286353 (erkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 529 aa AA seqDB search
MEPEFDHFQSQMDSDNTHQSTMFNVQDNNAILMSGMENVLQSPRQLQAAAQAQQQAAAQA
QQQQVQAQQVQAQQAQQQQQQQQNQQQQQQQQNQQNQQQQQNQQQQSQQMTQQQLQQLMP
PPPTSDTSNFNDNISYFVYGSQFTVPRRYSIVKCIGHGAYGVVCSAKDNLTGEKVAIKKI
SKAFDNLKDTKRTLREIHLLRHFKHENLISIKDILKPNSKEQFEDVYIVSELMDTDLHQI
ITSPQPLSDDHCQYFVYQMLRGLKHIHSANVLHRDLKPSNLLINEDCLLKICDLGLARVE
DATHQGFMTEYVATRWYRAPEVILSWNKYTKAIDIWSVGCIFAELLGRKPLFQGKDYIHQ
ITLIIETIGSPSEEDICNIANEQARQFIRNMGNQPKVNFANMFPKANPDAIDLLERMLYF
DPSKRLTVEEALAHPYFQSLHDPSDEPICLHKFSLNFEAWDLNRDLLKELIYNEMLAYHP
EDPQAPYYTDLNNPNFNLSRIQSSSELFNLLQQQKQQIHQQVNQQSIKN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagaatttgatcactttcaatcacaaatggattccgataatacacaccaatca
acaatgtttaatgtccaagataataatgccattctaatgagtggaatggaaaatgttctc
caatctccacgtcaattacaagcagctgcacaagcacaacaacaagcagctgcacaagct
caacaacaacaagtacaagctcaacaagtacaagctcaacaagcacaacaacaacaacaa
caacaacaaaaccaacaacaacaacaacaacaacaaaaccaacaaaaccaacaacaacaa
caaaatcaacaacaacaatcacaacaaatgacacaacaacaattacaacaattaatgcca
ccaccaccaacaagtgatacaagtaattttaatgataatatatcatattttgtatatgga
tcacaatttacagtaccaagaagatattcaatagtaaagtgtataggacatggtgcctat
ggagttgtttgttctgccaaagataatttaacaggagaaaaggttgcaattaaaaagatt
agtaaagcatttgacaatttaaaagatacaaaacgtacattacgtgaaattcatttactt
agacattttaaacatgaaaatcttatctcgatcaaggatatattgaaaccaaatagtaaa
gagcaatttgaagacgtttatatagtttcagaattgatggatacagatttacaccaaatt
ataacttcaccacaaccattatcggatgatcattgtcaatatttcgtttatcaaatgtta
cgtggtctaaaacatattcattcagcaaatgtattacatagagatttaaaaccttcaaac
cttttaataaatgaagattgtctattaaaaatttgtgatcttggtcttgctcgtgttgaa
gatgcaactcatcaaggttttatgactgaatacgttgcaactcgttggtatcgtgctcct
gaagtcattctatcttggaataaatatacaaaagcaattgatatttggtctgtaggttgt
attttcgctgaacttttaggtagaaaacctttattccaaggaaaagattatattcatcaa
attacattaattatagaaactattggatcaccatcagaagaagatatttgtaatattgca
aatgaacaagcacgtcaatttataagaaatatgggtaaccaaccaaaagttaattttgca
aatatgttcccaaaagcaaatccagatgcaattgatttattagaaagaatgttatatttt
gatccaagtaagagattaacggttgaggaagctttggcacatccatattttcaatcttta
catgacccatcagatgaaccaatttgtttacataagtttagtttaaattttgaagcatgg
gatttaaatagagatttattaaaagaattaatttataatgaaatgttagcttatcatcct
gaagatccacaggcaccatactatactgacttaaataatcctaatttcaatttatcaaga
attcaatcttcaagtgaattatttaatttattacaacaacaaaaacaacaaatacatcaa
caagtaaatcaacaatcaattaaaaattaa

DBGET integrated database retrieval system