KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286427Help
Entry
DDB_G0286427      CDS       T00245                                 

Gene name
uox
Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ddi00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:ddi00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 287 aa AA seqDB search
MATLIDNRYGKARVRVLRVFKGPNEYHKVFDFDCRVLLRGAEFSETYLTGDNSKVVATDT
MKNTVYVIAQKEEFKSLEEYGILLGKHFLATYSWVNGVEVVMRENQWRRIKTSNGKEQAH
SFQRDREIHSVTVTSSRDKSPVVVSGIDDLLIMKTTQSGFEGFHRDKYTSLKETKDRVFA
TVVTANWTYNTLSVDYSKVFEQFKLSVFDIFAQTYSRSVQETLFLIAKDVISKVPQVEQV
HLSLPNKHAFGFDFSRLNIENNQTVFQPVEEPSGLIEGTIKRSHSRL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcaacattaattgataatagatatggtaaagcaagagttcgtgtattaagagtattt
aaaggaccaaatgaatatcataaagtatttgatttcgattgtcgtgtattattaagggga
gccgaattctcagagacctatttaaccggggacaatagtaaagttgtagccacagatacc
atgaagaatacagtctatgtgattgcacaaaaagaagaattcaagagtttagaagagtat
ggtattttattgggtaaacactttttagccacctattcatgggtaaacggagttgaggtt
gtcatgcgtgagaatcaatggcgtcgtattaagacctccaatggcaaggaacaagctcat
tcattccaacgtgatagagagatccattcggttacagtgacatcatctcgtgacaaatca
ccagtggttgtctctggtattgacgatcttttgattatgaaaaccactcaaagcggattc
gaaggtttccaccgtgacaaatacacctcattgaaagagaccaaagatagagtctttgca
actgtagttactgcaaattggacttacaatacattgtctgtagattattcaaaagtattt
gaacaattcaaactctctgtattcgatatctttgctcaaacttactctcgttccgttcaa
gagaccctcttcctcattgccaaagatgtcatctccaaagtaccacaagttgaacaagtc
cacctttcccttccaaataaacatgcttttggtttcgatttctcacgtttaaatattgaa
aataatcaaactgttttccaaccagttgaagaaccatcaggtttaatcgaaggtacaatt
aaaagatcacattcaagattataa

DBGET integrated database retrieval system