KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286509Help
Entry
DDB_G0286509      CDS       T00245                                 

Gene name
H2Bv3
Definition
(RefSeq) histone H2B domain-containing protein
  KO
K11252  histone H2B
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    DDB_G0286509 (H2Bv3)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0286509 (H2Bv3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-T_C
Motif
Other DBs
NCBI-GeneID: 8625650
NCBI-ProteinID: XP_637684
dictyBase: DDB_G0286509
UniProt: Q54LP8
Position
4
AA seq 154 aa AA seqDB search
MVFVKGQKKATKGSTQSGEEKTASTTPKVTKTPTEGGEKKRKKRKSDYTSFSTYIHKLLK
QITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIATEASGLAKKKKRQTLHSRDI
QVAVRIILTGELAKHAILQGMTAVNKYNPTESKN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtattcgttaaaggtcaaaagaaagcaaccaaaggttcaactcaatctggtgaagag
aaaaccgcttcaaccaccccaaaagtaaccaaaaccccaactgaaggtggtgaaaagaag
agaaagaagagaaagtctgactacacctcattctcaacctacatccacaagttattgaaa
caaattactccaccaaccaatgccaagagtaatgaaaaaggtgatagaaaattcactatc
tcatccaaagccatgtctgtaatgaactcctttgtccacgatatctttgacagaatcgcc
accgaagcttctggtttagccaaaaagaagaagagacaaactttacactcaagagatatt
caagttgccgttcgtatcattctcactggtgagttagctaaacatgccatcttacaaggt
atgactgctgtcaacaagtacaatccaactgaaagcaaaaactaa

DBGET integrated database retrieval system