KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286509Help
Entry
DDB_G0286509      CDS       T00245                                 

Gene name
H2Bv3
Definition
histone H2B domain-containing protein
Orthology
K11252  
histone H2B
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0286509 (H2Bv3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 154 aa AA seqDB search
MVFVKGQKKATKGSTQSGEEKTASTTPKVTKTPTEGGEKKRKKRKSDYTSFSTYIHKLLK
QITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIATEASGLAKKKKRQTLHSRDI
QVAVRIILTGELAKHAILQGMTAVNKYNPTESKN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtattcgttaaaggtcaaaagaaagcaaccaaaggttcaactcaatctggtgaagag
aaaaccgcttcaaccaccccaaaagtaaccaaaaccccaactgaaggtggtgaaaagaag
agaaagaagagaaagtctgactacacctcattctcaacctacatccacaagttattgaaa
caaattactccaccaaccaatgccaagagtaatgaaaaaggtgatagaaaattcactatc
tcatccaaagccatgtctgtaatgaactcctttgtccacgatatctttgacagaatcgcc
accgaagcttctggtttagccaaaaagaagaagagacaaactttacactcaagagatatt
caagttgccgttcgtatcattctcactggtgagttagctaaacatgccatcttacaaggt
atgactgctgtcaacaagtacaatccaactgaaagcaaaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system