KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286755Help
Entry
DDB_G0286755      CDS       T00245                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ddi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ddi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 204 aa AA seqDB search
MKVSIIVAVSKNNVIGTKAGDIPWELPKDLKHFRDTTHGFPCIIGRISLEAFGDLLPNRF
NIIVSSKKEFINIREKIAINLPEYETGITEKGAQYVIVKSVKEAVDYAKDILKTDLVYIC
GGKGIYEDSQQYSHELIITDVDVHIEENDVVIYNPFPSNDERNKWKVVNQIHHPKDHQNN
LDFSITYYVKNEEILIDYKVENQN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttcaattatagttgcagtttcaaaaaataatgttataggtacaaaagccggt
gacattccatgggaattaccaaaagatttaaaacattttagagatacaactcatggtttt
ccatgtattattggtagaatttcattagaagcatttggagatttattaccaaacagattt
aatataattgtttcatcaaaaaaagaatttattaatattagagagaaaattgcaattaat
ttaccagaatatgagacaggtataacagaaaagggagcccaatatgttattgtaaaaagt
gttaaagaagcagttgattatgcaaaagatatattgaaaacagatttagtttatatttgt
ggtggtaaaggaatttatgaggactcacaacaatattcacatgaattaattatcaccgat
gttgatgttcatattgaagagaatgatgttgtaatttataatccattcccttcaaatgat
gaaagaaataaatggaaagttgtaaaccaaattcatcacccaaaagatcatcaaaataat
ttagatttctcaattacgtattatgttaaaaatgaagaaatattaatagattataaagtt
gaaaatcaaaattaa

DBGET integrated database retrieval system