KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286755Help
Entry
DDB_G0286755      CDS       T00245                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DDB_G0286755
   00670 One carbon pool by folate
    DDB_G0286755
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DDB_G0286755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
4
AA seq 204 aa AA seqDB search
MKVSIIVAVSKNNVIGTKAGDIPWELPKDLKHFRDTTHGFPCIIGRISLEAFGDLLPNRF
NIIVSSKKEFINIREKIAINLPEYETGITEKGAQYVIVKSVKEAVDYAKDILKTDLVYIC
GGKGIYEDSQQYSHELIITDVDVHIEENDVVIYNPFPSNDERNKWKVVNQIHHPKDHQNN
LDFSITYYVKNEEILIDYKVENQN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttcaattatagttgcagtttcaaaaaataatgttataggtacaaaagccggt
gacattccatgggaattaccaaaagatttaaaacattttagagatacaactcatggtttt
ccatgtattattggtagaatttcattagaagcatttggagatttattaccaaacagattt
aatataattgtttcatcaaaaaaagaatttattaatattagagagaaaattgcaattaat
ttaccagaatatgagacaggtataacagaaaagggagcccaatatgttattgtaaaaagt
gttaaagaagcagttgattatgcaaaagatatattgaaaacagatttagtttatatttgt
ggtggtaaaggaatttatgaggactcacaacaatattcacatgaattaattatcaccgat
gttgatgttcatattgaagagaatgatgttgtaatttataatccattcccttcaaatgat
gaaagaaataaatggaaagttgtaaaccaaattcatcacccaaaagatcatcaaaataat
ttagatttctcaattacgtattatgttaaaaatgaagaaatattaatagattataaagtt
gaaaatcaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system