KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287333Help
Entry
DDB_G0287333      CDS       T00245                                 

Gene name
eIF3s1
Definition
eIF-3 alpha
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ddi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 219 aa AA seqDB search
MSDWSDLQKDKWINENREVEEVDAWDASSEDEVEKVEEEIKEPPKPVVKQLTKKQALQRA
IELKEKELKEPQGDFDIYLEEKRKKELQEASDLENSKNLFSGLSVKESSSGEPISTFIPK
TEKDFEQYSQIVSDYLLKYDSSIHYATFFKSLMKKVLVNVSSSDMNDISKTLTVLINEKL
KNEKSGKGGNKTKTKVAPKKIHMGNELQNYDDFDDDDFM
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattggagtgaccttcaaaaagataaatggattaatgaaaatagagaagttgaa
gaagttgatgcatgggatgcatcatcagaagatgaagtagaaaaagttgaagaagaaatt
aaagaaccaccaaaaccagttgttaaacaattaacaaagaaacaagcattgcaaagagca
attgaattaaaagaaaaagaattaaaagaaccacaaggtgactttgatatttatttagaa
gagaaaagaaagaaagaattacaagaagcatctgatttagaaaacagtaaaaatttattc
tctggtttatccgttaaagaatcatcatcaggtgaaccaatttcaacttttattccaaaa
actgaaaaagattttgaacaatattctcaaatcgtttctgattatttattaaaatatgat
tcatcaattcattatgctactttctttaaatcattaatgaaaaaagttttagttaatgta
tcatcatcagatatgaatgatatttcaaaaactttaacagttttaattaatgaaaaatta
aagaatgaaaaatctggtaaaggtggtaataaaacaaaaacaaaggttgcaccaaaaaag
attcacatgggaaatgaattacaaaactatgatgattttgatgatgatgattttatgtaa

DBGET integrated database retrieval system