KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287569Help
Entry
DDB_G0287569      CDS       T00245                                 

Gene name
agl
Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
Position
5
AA seq 1608 aa AA seqDB search
MRISNNNSESGNCGVEYTKLIDSFSEKIRIKDHCVNISTNTSTETKNNNSNINQDIYTIT
LVGNGSEPPFNAKGLVLPSLGTLRIIIPAGLEVASYNPQIYTNYHHGTDPTSSFQRDKFY
IFHKGNIIGYNGNNDLIFEQKIEKYGCFDYYVEWEEVASKNVKCGQIGTFQINPMLKINQ
QVIPSESICLQTFLTKCMGSIDQWEKHIETASKLGFNMIHYTPVQEIGESGSSYSIYDQQ
SISSKIFEGGMNRKIINEDEKLLALSSFISDAEKKYGVLGMIDLVWNHTANNSAWLNQHP
EAGYNTDNSPHLKSAVQLDQALQDYGKTLYGKEINNIDQLNDVINDVKTKVLPPLKLWEY
YVLDIEKEVEIFKNTFFSSGRVKEQIPSSCSTFSPSFLKNIISNPNHEKHEQIKSISKNG
IIRAPSYERYSLHINLDYTYKVLDTSVTFSNNSSPEEQIQKYRDILSIVNLEIYKDFDHD
TEAILKNIFERIKYERVSDHGPKLGKITKSKPLLTSYFTIVQYRDPNNSSIREIPLANNG
WIFNHNPTVDFASSESRAYLRRDVIVWGDCVKMRYGQSPSDNQWLWNHMKTYTQNMARIF
HAIRIDNCHSTPIHLAQYLLDAAREIRPDIYITCELFTGSEEIDYFFVKKLGINSLIREA
MQCGDSSEFTRVLYRYGGRPIGSIQEPPIGEYLNGCCSRNLGGGIISPNDYASKSLKPSL
PPALFMDCTHDNETPHQKRTIADTLSNAAIVAMSACAIGSTRGYDEIFPKTIDLVNETRV
YNTNVNLSSGILPIRSLLSKIHLELSCNGFDEIHIHQDGNLIFIQRYSPKLNESIFMVAH
CSFSNQQQQQQQDNDKELHVPCKISQFLFGAKITNTHINRNDWNTNTTKLNGIEVDCEIH
YHDKVLNQFCQIHEYNNENGALCTTLKLNNFKAGSILFFRGEIPKPNIESIRKIEQLILD
ENNQLCKSFDNVDLIDMNVLLFRINEEEKQVIGHGAYHVQNPVGELSFCGLQGFVTELNQ
IAKHNDLGNQLCGNLRKGNWAIDYIVNRLDQRVALKSVKQWLTQCFDQLKQLPRHLIPMY
FYQIIMTTYRFATNKSIEKMGNSFVKESDSWFSRALALTSIQFFGVSTPLISNPNVLEGV
KDREASLAAGFPHFATGYMRSWGRDTFISLRGILLVTNRYREAINIIVGFGSCLRFGLIP
NLLDCGTKPRFNSRDSVWWYLRSIQDTYNCLPTEKEKDQFLNQTKVYRLFPPTNYISPIS
TIAEIIQEILQAHASGIHFREPNAGREIDDRMRDEGFNISIDLNLTNGFLYGGNRSNCGT
WMDKMGESTKANNYGEPATPRDGAPIEITAMLYSTLSWISDLYKLDKFKHGGVEILKSKD
NNDNNNNNNSKTDILTYQDWSKLIETNFEKYYYVPSSGDDKKYIINSNYVHRRFIYKDVV
GSANVFSDYQLRPNICVAMSFAPKLFNDQHANKCIDIIRNSLVGPIGMKTLDPNDPNYHG
NYDNSSDSGYKPTSRGFNYHNGPEWVWCYGFFLESIVQFKQFPSISTKNHLINSLLIKHK
LYIQNDKRFSLPELTNREGSFCKDSCDSQAWSIATILASPYQLSITKN
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttcaaataataattcagaatctggtaattgtggtgttgaatatacaaagtta
attgattcattttctgaaaagattagaattaaagatcattgtgtcaatatttcaacaaat
accagtactgaaactaaaaataataatagtaatataaatcaagatatctatacaattaca
ttggtcggaaatggatcagaaccacctttcaatgcaaaaggattagtattaccatcatta
ggtactttaagaattattataccagcaggtcttgaagttgcatcatataatccacaaatt
tatacaaattatcatcatggtaccgatccaacttcatcatttcaacgtgataaattttat
attttccataaaggtaatattataggatataatggtaataatgatttaatatttgaacaa
aagattgaaaaatatggttgttttgattattatgttgaatgggaagaagttgcaagtaaa
aatgtaaaatgtggtcaaattggaacatttcaaattaatccaatgttaaagattaatcaa
caagtgataccaagtgagtcaatttgtttacaaacattccttaccaaatgtatgggatca
attgatcaatgggagaaacatattgagacagcatcaaaacttggtttcaatatgattcat
tatacaccagttcaagagattggtgaaagtggttcatcctatagtatctatgatcaacaa
tcaatctcttcaaagatattcgagggtgggatgaataggaaaatcatcaatgaagatgag
aaactattggcattgtcatcattcattagtgatgcagagaaaaagtatggtgtattgggt
atgattgatttggtttggaatcatacagcaaataattcagcatggttaaatcaacatcca
gaagctggttacaatactgataactcaccacatttgaaatccgcagttcaattggatcaa
gcattacaagactatggcaaaacattgtatggtaaagagataaacaacatcgatcaattg
aatgatgtaatcaatgatgttaaaaccaaagtattaccaccattgaaactttgggaatat
tatgtgttggatatcgaaaaggaggttgaaatatttaaaaacacttttttctcatcgggt
agagttaaggagcaaattccatcatcatgctcaacattttcaccatcatttttaaagaat
atcatctccaatccaaatcatgagaaacatgaacaaatcaaatcaatctcaaagaatggt
ataattcgtgctccatcctatgagcgttattcgcttcatatcaatttggattacacttat
aaggttttggatacttcagtaaccttttcaaataattcatcaccagaggaacaaattcaa
aagtatcgtgatatactatcaattgtaaatttagagatttataaagatttcgatcatgat
accgaggcaattttaaagaatattttcgaaagaattaaatatgaacgtgttagtgatcat
ggtccaaaacttggaaagattacaaagagtaaaccattgttgacatcatactttacaata
gtacaataccgtgatccaaataatagtagtattcgtgaaattccattggcaaataatggt
tggatatttaatcataatccaacagtggatttcgcaagtagtgaatcacgtgcctacctt
agacgtgatgtcattgtttggggtgattgtgtgaaaatgcgttatggtcaatcaccatca
gataaccaatggctttggaatcatatgaaaacttacactcaaaatatggctcgtattttc
catgcaattagaattgataattgtcattcaactccaattcatttagctcaatacctttta
gatgctgccagagaaattcgtccagacatctacataacgtgtgaactattcactggttct
gaagagattgattactttttcgtaaagaaattaggtataaattctctaattcgtgaagct
atgcaatgtggcgattcttcagaatttacaagagtactctatcgttatggtggtagacca
attggtagcattcaagaaccaccaataggtgaatatttaaatggttgttgttcaagaaat
cttggtggtggaataatatcaccaaatgattatgcttcaaaatcattaaaaccaagttta
ccacctgcactatttatggattgtactcatgataatgaaacaccccaccaaaagagaacc
atagccgatacattatcaaatgctgcaatcgttgcaatgtcagcttgtgccattggttcc
actagaggttatgatgaaatcttcccaaaaacaattgatctagtaaatgaaactagagtt
tacaataccaatgttaatctttcaagtggtattctaccaattagatcattattatcaaag
atacacttggaactatcatgtaatggttttgatgaaattcatattcatcaagatggtaat
ttaattttcattcaaagatattcaccaaaattaaatgaatcaatatttatggttgctcat
tgttcattctcaaatcaacaacaacaacaacagcaagataatgataaagaattacatgta
ccttgtaaaatttcacaatttttatttggtgcaaagattaccaatacccatatcaataga
aatgattggaatacaaatacaaccaaattgaatggtattgaagtagattgtgaaattcat
tatcatgataaagttttaaatcaattttgtcaaattcatgaatataacaatgagaatggt
gcactttgtacaacgttgaaattaaataactttaaagctggttccattttattctttaga
ggtgaaattccaaaaccaaatatagaatccattagaaagattgaacaattgattttggat
gaaaataatcaactctgtaaatcatttgacaatgttgatttaattgatatgaatgtacta
ttattcagaatcaatgaagaggagaaacaagtcattggtcatggtgcttatcatgtccaa
aatccagttggtgaattatcattctgtggtttacaaggtttcgtaactgaattaaatcaa
attgcaaagcataatgatttgggtaatcaattatgtgggaatcttagaaaaggcaattgg
gcaatcgattatatcgtcaatagattggatcaaagagtagccttgaaatcagtgaaacaa
tggttaactcaatgttttgatcaattgaaacaattaccaagacatttaataccaatgtat
ttctatcaaatcattatgacaacctatcgtttcgccacaaataaatccattgaaaagatg
ggtaattcattcgtaaaggagagtgattcttggttttcacgtgcattggctctcacgagt
atacaattctttggtgtttcaacaccattaatttcaaatccaaatgtattagaaggtgtt
aaagatagagaagcttcacttgctgctggtttcccacattttgcaactggttatatgaga
tcctggggtagagatactttcatatccctacgtggtatccttttagtgaccaatcgttat
cgtgaagcaattaatatcatcgttggatttggtagttgtttaagatttggtttaattcca
aatcttttagattgtggtaccaaaccaagattcaattcaagggattccgtttggtggtat
ttacgttcaattcaagatacttacaattgtttaccaacagagaaagagaaagatcaattt
ttaaatcaaactaaagtctatcgtttattcccacccacaaattacatttcgccaatctct
acaatcgcagagatcattcaagagattttacaagctcatgcaagtggtattcatttccgt
gaaccaaatgcaggtagagaaattgatgatagaatgagagatgaaggtttcaatattagc
attgatctaaatttaactaatggtttcctttatggtggtaatcgtagtaattgtggtact
tggatggataaaatgggtgaatcaacaaaagcaaacaactatggtgaacctgcaacaccc
cgtgatggagccccgattgaaatcactgcaatgctttattcaacattatcttggatctct
gatttatataaacttgataaatttaaacacggcggtgttgaaattttaaaatcaaaagat
aataacgataataataataataataatagcaaaactgatattttaacttatcaagattgg
tcaaaattaattgaaacaaattttgaaaaatattattatgttccatcaagcggtgatgat
aagaaatatattatcaattcaaattacgttcatcgtagattcatttataaagatgtagtt
ggtagtgcaaacgttttctctgattaccaattaagaccaaatatttgtgttgcaatgtca
tttgcaccaaagttattcaatgatcaacatgcaaataaatgtattgatatcattagaaat
tcattggttggtccaatcggtatgaaaactcttgatccaaatgatccaaattatcatggt
aactatgataattcatcagattctggttataaaccaacatcaagaggtttcaattatcat
aatggtcctgaatgggtttggtgttatggtttctttttggaatcaattgtacaatttaaa
cagttcccttcgatttcaacaaagaatcatttaatcaattcattattaattaaacataaa
ctttacattcaaaatgataaacgtttctcattaccagagttaactaatcgtgaaggtagt
ttttgtaaagatagttgtgattctcaagcttggtcaattgcaacaattttagcttcacct
tatcaattatcaattactaaaaattaa

DBGET integrated database retrieval system