KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287659Help
Entry
DDB_G0287659      CDS       T00245                                 

Gene name
nagD
Definition
glycoside hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ddi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ddi00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ddi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ddi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 564 aa AA seqDB search
MKLKFIFLILFFIIGNSIGIKISKEINKIKLNDISIDGEILLNKSSDSSSSQSSKIINIW
PMPKKVLNGDITVYISPHFQFTTNLTKSTTLKKAMDRYYKLIFTEDSKSHSGISILNEIK
ILVKSEDETLQIGFDESYEIYIDDSGDDGGKIIAETVYGAIRGLETLYQMIGFDYQREYY
QIKHCPWIIQDSPRYPHRGVMLDTSRHFYSVDVLKEFIEALAYNKFNVFHWHAVDSQSFP
LTSTTFPKITKGSWSSQEIYSTRDIKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPSVL
PANFSHSIQCQQPCPTECNIPLDVSSKESYVIAMGLLEEFNGASMFNESFFHIGGDEVAY
SCWNNSLRIVDWMKRENISSFQDAAIFFEIKAIEQLIQLGKTPVMWEDAYLLFGSSGITE
KLPEEVVVQIYHDPLLALNTTRDGYKTLQSPYWPYYLDNPSVDWEKVYEFEPSNGIHEKR
LRLLLGGETCMWSELVDASNLFAKVFPRAFATAERLWFSIENSNSTTFAKPRLERFRCFL
LERGIGAAPLNSTSPDDPNSCYSS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaatttatttttttaattttattttttataattggtaattcaattggaatt
aaaatttcaaaagaaataaataaaattaaattaaatgatatttcaatagatggtgaaatt
ttattaaataaatcgagtgattcaagtagtagccaatcatcaaaaatcataaacatttgg
ccaatgccaaagaaagttttaaatggagatattacagtttacatttcaccacattttcaa
tttacaaccaatttaacaaaatcaacaactttaaaaaaagcaatggaccgttattataaa
ttaatttttactgaagattcaaaatcacattcaggtatttcaattttaaatgaaattaaa
attttagtaaaatcagaagatgaaacattacaaattggatttgatgaaagttatgaaatt
tatattgatgatagtggcgatgatggtggtaaaattatagctgaaacagtgtatggtgcc
attaggggattggagacgttatatcaaatgattggatttgattatcaacgtgaatattat
caaattaaacattgtccatggattattcaagactcaccaagatacccacatcgtggggtg
atgttggatactagtagacatttttattcggtagatgttttaaaggagtttattgaagca
cttgcctataacaaattcaatgtttttcattggcatgctgttgattctcagtcattccca
ttgacaagtacaacatttccaaagattaccaaaggttcatggtcaagccaagagatctat
tcaactagagatatcaaagagatcattcaacatgctaaagaatatggtattcgtgtggag
ttagagattgatatgcctggacatgcctatagttggggcattggctatccaagtgttttg
ccagcaaatttcagtcactcaattcagtgtcaacaaccatgtcctaccgaatgtaatata
ccattggatgtttcctccaaagaatcctatgtgattgccatgggtttattagaagagttc
aatggcgcttcaatgtttaatgaatcatttttccatattggtggtgatgaagttgcttat
tcatgttggaataattctttaagaatagtcgattggatgaagcgagagaatatatcaagt
tttcaagatgctgccattttctttgaaattaaagcaattgaacaattgattcagttgggt
aaaaccccagtaatgtgggaagatgcttatttattatttggttcaagtggtatcactgaa
aagttgcctgaagaggttgtagttcaaatataccatgatccactattggctttaaataca
actagagatggttataaaactttacaatcaccttattggccatactatttagataatcca
tcagttgattgggaaaaagtttatgaattcgaaccttcaaatggtatacacgaaaaaaga
cttcgtctactattgggtggtgaaacttgtatgtggtctgaattggttgatgcaagtaat
ttatttgcaaaagttttcccacgtgcttttgcaacagctgaaagactttggttttctata
gaaaattcaaattcaacaacttttgcaaaaccccgtttagaaagattccgttgtttttta
ttagaaagaggcattggtgctgcacctttaaattcaacttcccctgatgatccaaactca
tgttattcatcctaa

DBGET integrated database retrieval system