KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288481Help
Entry
DDB_G0288481      CDS       T00245                                 

Gene name
gchA
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DDB_G0288481 (gchA)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DDB_G0288481 (gchA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 232 aa AA seqDB search
MSDNLKSYQDNHIENEDEEIYERSNGKGKELVDFGKKREPLIHNHEVLNTMQSSVKTLLS
SLGEDPDREGLLKTPLRMSKALLFFTQGYEQSVDEVIGEAIFNENHHEMVVVRDIDIFSL
CEHHMVPFHGKCHIGYIPDQKVLGLSKLARVAEIFARRLQVQERLTRQIAQAIQAHLNPM
GVAVVIEASHMCMVMRGVQKPGASTVTSSVCGIFEKDSRTRAEFFSLIKSNK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaatttaaaatcataccaagataatcatattgaaaatgaagatgaagaaatt
tatgaaagatcaaatggaaaaggaaaggaattagttgattttggaaagaagagagaacca
ttaatccataaccatgaagttttaaatacaatgcaatcatcagtaaagacattattaagt
agtttaggtgaagatccagatagagaaggtttattaaagacaccattaagaatgtcaaag
gctttattattttttacacaaggttatgagcaatctgttgatgaagttattggtgaagca
atttttaatgaaaatcatcatgaaatggttgttgtcagagatattgatatattttcatta
tgtgaacatcatatggtgccattccatggtaaatgccatattggttatattccagatcaa
aaagttttaggtttaagtaaattagcaagagttgctgaaatttttgccagaaggttacaa
gttcaagaacgtttaaccagacaaatagcacaagcaattcaagctcacttaaatccaatg
ggtgttgccgtcgtaattgaagcatcacacatgtgtatggttatgagaggtgtacaaaaa
ccaggtgcaagtactgtcacctcatctgtttgcggtatttttgaaaaagactctagaact
cgtgctgaattctttagtttaattaaatcaaataaataa

DBGET integrated database retrieval system